![Western Blot: BEND2 Antibody [NBP2-38127] - Analysis in control (vector only transfected HEK293T lysate) and BEND2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/BEND2-Antibody-Western-Blot-NBP2-38127-img0006.jpg "Western Blot: BEND2 Antibody [NBP2-38127] - Analysis in control (vector only transfected HEK293T lysate) and BEND2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DQDDASASACLTPDFALLPLNILVKVDTNTENSVNTMNRSTLLDSDSGQDSSSSSVCIPPKYGYLGDPKRNVRVLKIHLLAVQNMAKPKQAACYLVRILFSKEILISSSVDIHLKDSQSLDPNKMAALREYLATTFPTCDLHEHG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BEND2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Flow-Cytometry-NBP1-97507-img0005.jpg)
-Immunohistochemistry-Paraffin-NBP1-97507-img0003.jpg)
-Western-Blot-NBP1-97507-img0004.jpg)
-Flow-Cytometry-NB100-56503-img0011.jpg)
-Flow-(Intracellular)-NB100-56503-img0014.jpg)
-Western-Blot-NB100-56503-img0015.jpg)
-Immunohistochemistry-NBP2-45725-img0001.jpg)
-Western-Blot-NBP2-45725-img0003.jpg)
-Immunohistochemistry-NBP2-45725-img0002.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for BEND2 Antibody (NBP2-38127)Discover more about diseases related to BEND2 Antibody (NBP2-38127).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: BEND2 Antibody [NBP2-38127] - Staining in human testis and endometrium tissues using anti-BEND2 antibody. Corresponding BEND2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/BEND2-Antibody-Immunohistochemistry-Paraffin-NBP2-38127-img0005.jpg "Immunohistochemistry-Paraffin: BEND2 Antibody [NBP2-38127] - Staining in human testis and endometrium tissues using anti-BEND2 antibody. Corresponding BEND2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: BEND2 Antibody [NBP2-38127] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/fullsize2/BEND2-Antibody-Immunohistochemistry-Paraffin-NBP2-38127-img0003.jpg "Immunohistochemistry-Paraffin: BEND2 Antibody [NBP2-38127] - Staining of human endometrium shows low expression as expected.")
![Immunohistochemistry-Paraffin: BEND2 Antibody [NBP2-38127] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize2/BEND2-Antibody-Immunohistochemistry-Paraffin-NBP2-38127-img0004.jpg "Immunohistochemistry-Paraffin: BEND2 Antibody [NBP2-38127] - Staining of human testis shows high expression.")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")