SCIMP Antibody

Images

 
Western Blot: SCIMP Antibody [NBP2-48502] - Analysis in control (vector only transfected HEK293T lysate) and SCIMP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Orthogonal Strategies: Immunohistochemistry-Paraffin: SCIMP Antibody [NBP2-48502] - Staining in human tonsil and pancreas tissues using anti-SCIMP antibody. Corresponding SCIMP RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: SCIMP Antibody [NBP2-48502] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: SCIMP Antibody [NBP2-48502] - Staining of human tonsil shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SCIMP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RRGKKWEIAKPLKHKQVDEEKMYENVLNESPVQLPPLPPRNWPSLEDSSPQEAPSQPPATYSLVNKVKNKKTVSIPSYIEPEDDYDDVEIPANTE
Specificity
Specificity of human SCIMP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCIMP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SCIMP Recombinant Protein Antigen (NBP2-48502PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SCIMP Antibody

  • transmembrane protein C17orf87
  • C17orf87
  • chromosome 17 open reading frame 87
  • DTFT5783
  • FLJ32580
  • SLP adapter and CSK-interacting membrane protein
  • SLP adaptor and CSK interacting membrane protein
  • SLP65/SLP76, Csk-interacting membrane protein
  • UNQ5783

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37585
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF3206
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
MAB7474
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00289
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-CS
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-796
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-85951
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92440
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-48502
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SCIMP Antibody (NBP2-48502) (0)

There are no publications for SCIMP Antibody (NBP2-48502).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCIMP Antibody (NBP2-48502) (0)

There are no reviews for SCIMP Antibody (NBP2-48502). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCIMP Antibody (NBP2-48502) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SCIMP Products

Array NBP2-48502

Bioinformatics Tool for SCIMP Antibody (NBP2-48502)

Discover related pathways, diseases and genes to SCIMP Antibody (NBP2-48502). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

PTMs for SCIMP Antibody (NBP2-48502)

Learn more about PTMs related to SCIMP Antibody (NBP2-48502).

Blogs on SCIMP

There are no specific blogs for SCIMP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCIMP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCIMP