Schlafen 11 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Schlafen 11 Antibody [NBP2-57084] - Staining of human cell line RH-30 shows localization to nucleus. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Schlafen 11 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ETSVRSMDSREAFCFLKTKRKPKILEEGPFHKIHKGVYQELPNSDPADPNSDPADLIFQKDYLEYGEILP
Specificity
Specificity of human Schlafen 11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLFN11
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Schlafen 11 Recombinant Protein Antigen (NBP2-57084PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Schlafen 11 Antibody

  • FLJ34922
  • schlafen family member 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67741
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-67606
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: GS, ICC/IF, IHC, IHC-P
NBP1-81178
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-82010
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-70706
Species: Hu
Applications: WB
NBP1-93879
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53281
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PA
NBP2-57084
Species: Hu
Applications: ICC/IF

Publications for Schlafen 11 Antibody (NBP2-57084) (0)

There are no publications for Schlafen 11 Antibody (NBP2-57084).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Schlafen 11 Antibody (NBP2-57084) (0)

There are no reviews for Schlafen 11 Antibody (NBP2-57084). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Schlafen 11 Antibody (NBP2-57084) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Schlafen 11 Products

Bioinformatics Tool for Schlafen 11 Antibody (NBP2-57084)

Discover related pathways, diseases and genes to Schlafen 11 Antibody (NBP2-57084). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Schlafen 11 Antibody (NBP2-57084)

Discover more about diseases related to Schlafen 11 Antibody (NBP2-57084).
 

Pathways for Schlafen 11 Antibody (NBP2-57084)

View related products by pathway.

Blogs on Schlafen 11

There are no specific blogs for Schlafen 11, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Schlafen 11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLFN11