SCAPER Antibody

Images

 
Immunohistochemistry-Paraffin: SCAPER Antibody [NBP2-13285] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCAPER Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KSPTKTRHPRKIDLRARYWAFLFDNLRRAVDEIYVTCESDQSVVECKEVL MMLDNYVRDFKALIDWIQLQEKLEKTDAQSRPTSLAWEVKKMSPGR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCAPER
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SCAPER Protein (NBP2-13285PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SCAPER Antibody

  • FLJ46212
  • KIAA1454FLJ31953
  • S phase cyclin A-associated protein in the endoplasmic reticulum
  • S phase cyclin A-associated protein in the ER
  • S-phase cyclin A-associated protein in the ER
  • Zfp291
  • Zinc finger protein 291FLJ31533
  • ZNF291

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-86562
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86057
Species: Hu
Applications: WB, IHC, IHC-P
MAB2096
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB200-342
Species: Hu, Mu
Applications: WB, IHC-P, IP
AF4737
Species: Hu
Applications: WB
H00006444-M01-100ug
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF1366
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-91915
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27543
Species: Hu
Applications: WB, PEP-ELISA
NBP1-97494
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, ICC/IF, IHC, IHC-P
MAB8494
Species: Hu
Applications: WB, IHC, ICC
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-2412
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00006938-M01
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NBP2-55973
Species: Hu
Applications: WB, ICC/IF
H00063876-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-58328
Species: Hu
Applications: ICC/IF
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for SCAPER Antibody (NBP2-13285) (0)

There are no publications for SCAPER Antibody (NBP2-13285).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCAPER Antibody (NBP2-13285) (0)

There are no reviews for SCAPER Antibody (NBP2-13285). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SCAPER Antibody (NBP2-13285) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCAPER Products

Bioinformatics Tool for SCAPER Antibody (NBP2-13285)

Discover related pathways, diseases and genes to SCAPER Antibody (NBP2-13285). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCAPER Antibody (NBP2-13285)

Discover more about diseases related to SCAPER Antibody (NBP2-13285).
 

Pathways for SCAPER Antibody (NBP2-13285)

View related products by pathway.

Blogs on SCAPER

There are no specific blogs for SCAPER, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCAPER Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCAPER