SART2 Antibody - BSA Free

Western Blot: SART2 Antibody [NBP3-11007] - Western blot analysis of SART2 in Human MCF7 Whole Cell lysates. Antibody dilution at 3ug/ml

Product Discontinued

SART2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SART2 Antibody - BSA Free (NBP3-11007) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SART2 (NP_001074445.1). Peptide sequence NRSFLSFKSGKLGGRAIYDIVHRNKYKDWIKGWRNFNAGHEHPDQNSFTF
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DSE
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 105 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SART2 Antibody - BSA Free

• Chondroitin-glucuronate 5-epimerase
• dermatan sulfate epimerase
• dermatan-sulfate epimerase
• DSEPI
• EC 5.1.3.19
• SART-2
• SART2DS epimerase
• squamous cell carcinoma antigen recognized by T cells 2
• Squamous cell carcinoma antigen recognized by T-cells 2

Background

SART2 is encoded by this gene is a tumor-rejection antigen. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunotherapy. This gene product is localized to the endoplasmic reticulum. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DSE