We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

S100A16 Recombinant Protein Antigen

Images

 
There are currently no images for S100A16 Protein (NBP1-92361PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

S100A16 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human S100A16.

Source: E. coli

Amino Acid Sequence: VIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
S100A16
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92361.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for S100A16 Recombinant Protein Antigen

  • AAG13
  • Aging-associated gene 13 protein
  • aging-associated protein 13
  • DT1P1A7
  • MGC17528
  • protein S100-A16
  • Protein S100-F
  • S100 calcium binding protein A16
  • S100A16
  • S100F
  • S100FS100 calcium-binding protein A16

Background

S100A16 is a gene that codes for a calcium-binding protein that is 103 amino acids long, with a weight of approximately 12 kDa. Current research is being done on diseases and disorders linked to this gene including carcinoma. S100A16 has also been shown to have interactions with S100A14, UCHL5, GABARAPL1, CERS2, and ECM1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87102
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87103
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-90000
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-43299
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-97675
Species: Ca, Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NBP2-27393
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
NBP1-89766
Species: Hu
Applications: ICC/IF,  IHC-P, WB
NBP3-41986
Species: Hu
Applications: WB
NBP3-18555
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88204
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF2128
Species: Mu
Applications: IHC, WB
NBP2-45745
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-90495
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-35541
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB

Publications for S100A16 Protein (NBP1-92361PEP) (0)

There are no publications for S100A16 Protein (NBP1-92361PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S100A16 Protein (NBP1-92361PEP) (0)

There are no reviews for S100A16 Protein (NBP1-92361PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for S100A16 Protein (NBP1-92361PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional S100A16 Products

Research Areas for S100A16 Protein (NBP1-92361PEP)

Find related products by research area.

Blogs on S100A16

There are no specific blogs for S100A16, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our S100A16 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A16