S100A10 Antibody (4D2-F1)

Immunocytochemistry/Immunofluorescence: S100A10 Antibody (4D2-F1) [H00006281-M01] - Analysis of monoclonal antibody to S100A10 on HeLa cell . Antibody concentration 10 ug/ml.

Sandwich ELISA: S100A10 Antibody (4D2-F1) [H00006281-M01] - Detection limit for recombinant GST tagged S100A10 is approximately 0.1ng/ml as a capture antibody.

Product Discontinued

S100A10 Antibody (4D2-F1) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: S100A10 (AAH15973, 1 a.a. ~ 97 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
• Specificity: S100A10 - S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11))
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: S100A10
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against recombinant protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been use for IF.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for S100A10 Antibody (4D2-F1)

• annexin II ligand, calpactin I, light polypeptide
• ANX2L
• ANX2LG
• CAL1LGP11,42C
• Calpactin I light chain
• Calpactin-1 light chain
• Cellular ligand of annexin II
• CLP11Ca[1]
• MGC111133
• p10 protein
• p10
• P11
• protein S100-A10
• S100 calcium binding protein A10 (annexin II ligand, calpactin I, lightpolypeptide (p11))
• S100 calcium binding protein A10
• S100 calcium-binding protein A10 (annexin II ligand, calpactin I, lightpolypeptide (p11))
• S100 calcium-binding protein A10
• S100A10

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in exocytosis and endocytosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: S100A10
• Entrez:
  • 6281(Human)
• OMIM:
  • 114085(Human)
• Uniprot:
  • AAH15973(Human)