Ryanodine Receptor 1 Recombinant Protein Antigen

Images

 
There are currently no images for Ryanodine Receptor 1 Recombinant Protein Antigen (NBP2-33785PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Ryanodine Receptor 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RYR1.

Source: E. coli

Amino Acid Sequence: REFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLYYLDQTEHPYKSKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RYR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33785.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Ryanodine Receptor 1 Recombinant Protein Antigen

  • CCO
  • central core disease of muscle
  • MHS
  • MHS1
  • PPP1R137
  • protein phosphatase 1, regulatory subunit 137
  • ryanodine receptor 1 (skeletal)
  • Ryanodine Receptor 1
  • ryanodine receptor type1
  • RYDR
  • RYR
  • RyR1
  • RYR-1
  • sarcoplasmic reticulum calcium release channel
  • Skeletal muscle calcium release channel
  • skeletal muscle ryanodine receptor
  • Skeletal muscle-type ryanodine receptor
  • SKRR
  • type 1-like ryanodine receptor

Background

The Ryanodine Receptor (RyR) is the channel responsible for the release of calcium from the sarcoplasmic reticulum (SR) in muscle cells and also plays a role in calcium regulation in non-muscle cells. The RyR exists as a homotetramer and is predicted to have a short cytoplasmic C-terminus and 4-10 transmembrane domains; the remainder of the protein, termed the "foot" region is located in the cytoplasm between the T-tubule and the SR. The mammalian RyR is the product of three different genes: RyR 1, which is expressed predominantly in skeletal muscle and areas of the brain, RyR 2, which is expressed predominantly in the heart muscle but also found in the stomach, endothelial cells and diffuse areas of the brain, and RyR-3 which is found in smooth muscle and the brain (striatum, thalamus and hippocampus).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5745
Species: Hu
Applications: IHC, WB
NBP1-86125
Species: Hu
Applications: IHC,  IHC-P
NB300-542
Species: Gp, Hu, Mu, Rb, Rt
Applications: Flow, IHC, IHC-Fr,  IHC-P, IP, WB
AF8038
Species: Hu, Mu, Rt
Applications: WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-21398
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
MAB1228
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP
H00002316-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, PLA, WB
NBL1-11414
Species: Hu
Applications: WB
NBP1-21399
Species: Hu
Applications: IHC,  IHC-P, IP, WB (-)
NBP1-90091
Species: Hu, Mu
Applications: ICC/IF, IHC-FrFl, IHC,  IHC-P
NBP2-19807
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-76559
Species: Hu
Applications: ICC/IF
NBP1-87417
Species: Hu
Applications: ICC/IF, IHC,  IHC-P

Publications for Ryanodine Receptor 1 Recombinant Protein Antigen (NBP2-33785PEP) (0)

There are no publications for Ryanodine Receptor 1 Recombinant Protein Antigen (NBP2-33785PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ryanodine Receptor 1 Recombinant Protein Antigen (NBP2-33785PEP) (0)

There are no reviews for Ryanodine Receptor 1 Recombinant Protein Antigen (NBP2-33785PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Ryanodine Receptor 1 Recombinant Protein Antigen (NBP2-33785PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ryanodine Receptor 1 Products

Research Areas for Ryanodine Receptor 1 Recombinant Protein Antigen (NBP2-33785PEP)

Find related products by research area.

Blogs on Ryanodine Receptor 1

There are no specific blogs for Ryanodine Receptor 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Ryanodine Receptor 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RYR1