Recombinant Human RPS9 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human RPS9 Protein [H00006203-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human RPS9 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 105-194 of Human RPS9

Source: Wheat Germ (in vitro)

Amino Acid Sequence: FLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKNAKKGQGGAGAGDDEEED

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
RPS9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
35.64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RPS9 GST (N-Term) Protein

  • ribosomal protein S9,40S ribosomal protein S9

Background

RPS9 - ribosomal protein S9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
H00006201-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-87797
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
NBP2-94118
Species: Hu, Mu, Rt
Applications: WB
NBP1-80959
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00006192-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00006193-M02
Species: Hu, Mu, Pr, Rt
Applications: ELISA, ICC/IF, WB
NBP2-94073
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-73636
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
NBP2-94502
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-345
Species: Hu
Applications: ChIP, IP, KD, WB
H00006202-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB100-2682
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-81545
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02563
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-1595
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB100-2452
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB

Publications for RPS9 Partial Recombinant Protein (H00006203-Q01) (0)

There are no publications for RPS9 Partial Recombinant Protein (H00006203-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPS9 Partial Recombinant Protein (H00006203-Q01) (0)

There are no reviews for RPS9 Partial Recombinant Protein (H00006203-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPS9 Partial Recombinant Protein (H00006203-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPS9 Products

Array H00006203-Q01

Bioinformatics Tool for RPS9 Partial Recombinant Protein (H00006203-Q01)

Discover related pathways, diseases and genes to RPS9 Partial Recombinant Protein (H00006203-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPS9 Partial Recombinant Protein (H00006203-Q01)

Discover more about diseases related to RPS9 Partial Recombinant Protein (H00006203-Q01).
 

Pathways for RPS9 Partial Recombinant Protein (H00006203-Q01)

View related products by pathway.

Blogs on RPS9

There are no specific blogs for RPS9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RPS9 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS9