Recombinant Human RPS6KC1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RPS6KC1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 957-1066 of Human RPS6KC1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SCDSDAIERMYCAPEVGAITEETEACDWWSLGAVLFELLTGKTLVECHPAGINTHTTLNMPECVSEEARSLIQQLLQFNPLERLGAGVAGVEDIKSHPFFTPVDWAELMR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RPS6KC1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RPS6KC1 Protein

  • EC 2.7.11.1
  • humS6PKh1
  • ribosomal protein S6 kinase delta-1
  • ribosomal protein S6 kinase, 52kD, polypeptide 1,52 kDa ribosomal protein S6 kinase
  • ribosomal protein S6 kinase, 52kDa, polypeptide 1
  • Ribosomal S6 kinase-like protein with two PSK domains 118 kDa protein
  • RPK118
  • S6K-delta-1
  • SPHK1-binding protein

Background

RPS6KC1 - ribosomal protein S6 kinase, 52kDa, polypeptide 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008877-M01
Species: Hu
Applications: WB, ELISA
NBP2-19777
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-32276
Species: Hu
Applications: WB, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90230
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47203
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP2-57242
Species: Hu
Applications: WB, ICC/IF
MAB3481
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF4838
Species: Hu
Applications: WB, Simple Western
MAB79671
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-52555
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
MAB5277
Species: Hu
Applications: WB, IHC
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-31406
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14279
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29936
Species: Hu, Mu
Applications: WB, Flow, IHC-P
H00026750-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for RPS6KC1 Partial Recombinant Protein (H00026750-Q01) (0)

There are no publications for RPS6KC1 Partial Recombinant Protein (H00026750-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPS6KC1 Partial Recombinant Protein (H00026750-Q01) (0)

There are no reviews for RPS6KC1 Partial Recombinant Protein (H00026750-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPS6KC1 Partial Recombinant Protein (H00026750-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPS6KC1 Products

Bioinformatics Tool for RPS6KC1 Partial Recombinant Protein (H00026750-Q01)

Discover related pathways, diseases and genes to RPS6KC1 Partial Recombinant Protein (H00026750-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPS6KC1 Partial Recombinant Protein (H00026750-Q01)

Discover more about diseases related to RPS6KC1 Partial Recombinant Protein (H00026750-Q01).
 

Pathways for RPS6KC1 Partial Recombinant Protein (H00026750-Q01)

View related products by pathway.

PTMs for RPS6KC1 Partial Recombinant Protein (H00026750-Q01)

Learn more about PTMs related to RPS6KC1 Partial Recombinant Protein (H00026750-Q01).
 

Research Areas for RPS6KC1 Partial Recombinant Protein (H00026750-Q01)

Find related products by research area.

Blogs on RPS6KC1

There are no specific blogs for RPS6KC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RPS6KC1 Antibody
NBP1-83141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RPS6KC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS6KC1