Recombinant Human RPS4Y1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RPS4Y1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-263 of Human RPS4Y1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQSSG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
RPS4Y1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RPS4Y1 Protein

  • 40S ribosomal protein S4, Y isoform 1
  • MGC119100
  • MGC5070
  • ribosomal protein S4, Y-linked 1,40S ribosomal protein S4, Y
  • Y-linked

Background

Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes ribosomal protein S4, a component of the 40S subunit. Ribosomal protein S4 is the only ribosomal protein known to be encoded by more than one gene, namely this gene and ribosomal protein S4, X-linked (RPS4X). The 2 isoforms encoded by these genes are not identical, but are functionally equivalent. Ribosomal protein S4 belongs to the S4E family of ribosomal proteins. It has been suggested that haploinsufficiency of the ribosomal protein S4 genes plays a role in Turner syndrome; however, this hypothesis is controversial. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NB100-345
Species: Hu
Applications: WB, ChIP, IP
NBP2-20228
Species: Hu, Ze
Applications: WB
NBP2-58885
Species: Hu
Applications: WB, ICC/IF
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-22298
Species: Hu, Mu
Applications: IP (-), WB, IHC-P
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92350
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP1-46191
Species: Hu, Mu
Applications: WB, IP
NBP1-82761
Species: Hu
Applications: IHC, IHC-P

Publications for RPS4Y1 Recombinant Protein (H00006192-P01) (0)

There are no publications for RPS4Y1 Recombinant Protein (H00006192-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPS4Y1 Recombinant Protein (H00006192-P01) (0)

There are no reviews for RPS4Y1 Recombinant Protein (H00006192-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPS4Y1 Recombinant Protein (H00006192-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPS4Y1 Products

RPS4Y1 H00006192-P01

Bioinformatics Tool for RPS4Y1 Recombinant Protein (H00006192-P01)

Discover related pathways, diseases and genes to RPS4Y1 Recombinant Protein (H00006192-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPS4Y1 Recombinant Protein (H00006192-P01)

Discover more about diseases related to RPS4Y1 Recombinant Protein (H00006192-P01).
 

Pathways for RPS4Y1 Recombinant Protein (H00006192-P01)

View related products by pathway.

Research Areas for RPS4Y1 Recombinant Protein (H00006192-P01)

Find related products by research area.

Blogs on RPS4Y1

There are no specific blogs for RPS4Y1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CD20 Antibody (AISB12)
NBP1-43435-0.1mg
5-HT1B Antibody
NB100-56350

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RPS4Y1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS4Y1