RPS28 Antibody (2F9) - Azide and BSA Free

Western Blot: RPS28 Antibody (2F9) [H00006234-M02] - Detection against Immunogen (31.79 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2F9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RPS28 Antibody (2F9) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: RPS28 (NP_001022, 1 a.a. ~ 55 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDTSRVQPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDV
• Specificity: RPS28 (2F9)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RPS28
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RPS28 Antibody (2F9) - Azide and BSA Free

• ribosomal protein S28,40S ribosomal protein S28

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S28E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPS28
• Entrez:
  • 6234(Human)
• OMIM:
  • 603685(Human)
• Uniprot:
  • NP_001022(Human)