We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

RPS2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RPS2 Antibody [NBP2-47295] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & endoplasmic reticulum.
Immunohistochemistry-Paraffin: RPS2 Antibody [NBP2-47295] - Staining of human testis shows very weak positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: RPS2 Antibody [NBP2-47295] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: RPS2 Antibody [NBP2-47295] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: RPS2 Antibody [NBP2-47295] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related RPS2 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-47295
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RPS2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQ
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPS2 Antibody

  • LLREP3
  • MGC102851
  • MGC117344
  • MGC117345,40S ribosomal protein S4
  • OK/KNS-cl.6,40S ribosomal protein S2
  • Protein LLRep3
  • ribosomal protein S2
  • RPS4

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S5P family of ribosomal proteins. It is located in the cytoplasm. This gene shares sequence similarity with mouse LLRep3. It is co-transcribed with the small nucleolar RNA gene U64, which is located in its third intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-46656
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP3-46655
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-80959
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00006193-M02
Species: Hu, Mu, Pr, Rt
Applications: ELISA, ICC/IF, WB
NBP2-19933
Species: Hu, Mu
Applications: IP, WB
NBP1-33691
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NB100-1595
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP1-86636
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80992
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00011329-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-90816
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-143
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC,  IHC-P, IP, ISH, KD, KO, PAGE, WB
NBP2-94504
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
H00006223-M01
Species: Hu, Mu
Applications: ELISA, WB
NBP2-02710
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-22439
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NBP3-25721
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA, WB
H00006201-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB

Publications for RPS2 Antibody (NBP2-47295) (0)

There are no publications for RPS2 Antibody (NBP2-47295).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPS2 Antibody (NBP2-47295) (0)

There are no reviews for RPS2 Antibody (NBP2-47295). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RPS2 Antibody (NBP2-47295) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPS2 Products

Research Areas for RPS2 Antibody (NBP2-47295)

Find related products by research area.

Blogs on RPS2

There are no specific blogs for RPS2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS2