RPS16 Antibody

Images

 
Western Blot: RPS16 Antibody [NBP2-32384] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: RPS16 Antibody [NBP2-32384] - Staining of human cell line MCF7 shows localization to cytosol & endoplasmic reticulum.
Immunohistochemistry-Paraffin: RPS16 Antibody [NBP2-32384] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPS16 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MPSKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPS16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RPS16 Protein (NBP2-32384PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPS16 Antibody

  • ribosomal protein S16,40S ribosomal protein S16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006223-M01
Species: Hu
Applications: WB, ELISA
NBP2-33717
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92350
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006218-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
H00006192-P01
Species: Hu
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80804
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13263
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20228
Species: Hu, Ze
Applications: WB
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57365
Species: Hu
Applications: WB
NB100-345
Species: Hu
Applications: WB, ChIP, IP
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83254
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6574
Species: Mu
Applications: WB
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-22298
Species: Hu, Mu
Applications: IP (-), WB, IHC-P

Publications for RPS16 Antibody (NBP2-32384) (0)

There are no publications for RPS16 Antibody (NBP2-32384).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPS16 Antibody (NBP2-32384) (0)

There are no reviews for RPS16 Antibody (NBP2-32384). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPS16 Antibody (NBP2-32384) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPS16 Products

Bioinformatics Tool for RPS16 Antibody (NBP2-32384)

Discover related pathways, diseases and genes to RPS16 Antibody (NBP2-32384). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPS16 Antibody (NBP2-32384)

Discover more about diseases related to RPS16 Antibody (NBP2-32384).
 

Pathways for RPS16 Antibody (NBP2-32384)

View related products by pathway.

PTMs for RPS16 Antibody (NBP2-32384)

Learn more about PTMs related to RPS16 Antibody (NBP2-32384).
 

Research Areas for RPS16 Antibody (NBP2-32384)

Find related products by research area.

Blogs on RPS16

There are no specific blogs for RPS16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPS16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS16