RPS12 Antibody

Images

 
Western Blot: RPS12 Antibody [NBP2-58885] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: RPS12 Antibody [NBP2-58885] - Staining of human cell line U-251 MG shows localization to cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPS12 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AAGGVMDVNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKDYGKESQAKDV
Specificity
Specificity of human RPS12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPS12
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RPS12 Antibody

  • ribosomal protein S12,40S ribosomal protein S12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
H00006192-P01
Species: Hu
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
NBP2-22288
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-13263
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-57365
Species: Hu
Applications: WB
NBP1-92450
Species: Hu
Applications: IHC, IHC-P
NBP1-80961
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00006223-M01
Species: Hu
Applications: WB, ELISA
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-36751
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-92350
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow

Publications for RPS12 Antibody (NBP2-58885) (0)

There are no publications for RPS12 Antibody (NBP2-58885).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPS12 Antibody (NBP2-58885) (0)

There are no reviews for RPS12 Antibody (NBP2-58885). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPS12 Antibody (NBP2-58885) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RPS12 Antibody (NBP2-58885)

Discover related pathways, diseases and genes to RPS12 Antibody (NBP2-58885). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPS12 Antibody (NBP2-58885)

Discover more about diseases related to RPS12 Antibody (NBP2-58885).
 

Pathways for RPS12 Antibody (NBP2-58885)

View related products by pathway.

PTMs for RPS12 Antibody (NBP2-58885)

Learn more about PTMs related to RPS12 Antibody (NBP2-58885).
 

Research Areas for RPS12 Antibody (NBP2-58885)

Find related products by research area.

Blogs on RPS12

There are no specific blogs for RPS12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPS12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS12