Recombinant Human RPRM GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human RPRM GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-109 of Human RPRM full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIAVMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
RPRM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
38.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RPRM GST (N-Term) Protein

  • candidate mediator of the p53 dependent G2 arrest
  • candidate mediator of the p53-dependent G2 arrest
  • FLJ90327
  • protein reprimo
  • REPRIMO
  • reprimo, TP53 dependant G2 arrest mediator candidate
  • reprimo, TP53 dependent G2 arrest mediator candidate

Background

RPRM may be involved in the regulation of p53-dependent G2 arrest of the cell cycle. Seems to induce cell cycle arrest by inhibiting CDC2 activity and nuclear translocation ofthe CDC2 cyclin B1 complex

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-86509
Species: Hu
Applications: IHC, IHC-P
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB
MAB3765
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, Simple Western, WB
5190-GR
Species: Hu
Applications: BA
NBP1-78977
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IM, IP, Simple Western, WB
NBP2-45780
Species: Hu
Applications: IHC, IHC-P, WB
NB120-10524
Species: Hu
Applications: ELISA, IP, MiAr, WB
H00084000-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
973-TM
Species: Hu
Applications: InhibAct
AF630
Species: Hu
Applications: IHC, Neut, WB
NBP1-76985
Species: Hu, Mu, Rt
Applications: ELISA, Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-02450
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00056475-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for RPRM Recombinant Protein (H00056475-P01) (0)

There are no publications for RPRM Recombinant Protein (H00056475-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPRM Recombinant Protein (H00056475-P01) (0)

There are no reviews for RPRM Recombinant Protein (H00056475-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPRM Recombinant Protein (H00056475-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPRM Products

Array H00056475-P01

Bioinformatics Tool for RPRM Recombinant Protein (H00056475-P01)

Discover related pathways, diseases and genes to RPRM Recombinant Protein (H00056475-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPRM Recombinant Protein (H00056475-P01)

Discover more about diseases related to RPRM Recombinant Protein (H00056475-P01).
 

Pathways for RPRM Recombinant Protein (H00056475-P01)

View related products by pathway.

PTMs for RPRM Recombinant Protein (H00056475-P01)

Learn more about PTMs related to RPRM Recombinant Protein (H00056475-P01).
 

Research Areas for RPRM Recombinant Protein (H00056475-P01)

Find related products by research area.

Blogs on RPRM

There are no specific blogs for RPRM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RPRM GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPRM