RPRM Antibody - BSA Free

Western Blot: RPRM Antibody [NBP2-95120] - Analysis of extracts of mouse pancreas, using RPRM at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

Product Discontinued

RPRM Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-109 of human RPRM (NP_062819.1). MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIAVMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPRM
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 11 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RPRM Antibody - BSA Free

• candidate mediator of the p53 dependent G2 arrest
• candidate mediator of the p53-dependent G2 arrest
• FLJ90327
• protein reprimo
• REPRIMO
• reprimo, TP53 dependant G2 arrest mediator candidate
• reprimo, TP53 dependent G2 arrest mediator candidate

Background

RPRM may be involved in the regulation of p53-dependent G2 arrest of the cell cycle. Seems to induce cell cycle arrest by inhibiting CDC2 activity and nuclear translocation ofthe CDC2 cyclin B1 complex

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPRM