Novus Biologicals products are now on bio-techne.com

RPL8 Recombinant Protein Antigen

Images

 
There are currently no images for RPL8 Recombinant Protein Antigen (NBP2-47297PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RPL8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPL8.

Source: E. coli

Amino Acid Sequence: VISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAMNPVEHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RPL8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47297.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RPL8 Recombinant Protein Antigen

  • ribosomal protein L8,60S ribosomal protein L8

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L2P family of ribosomal proteins. It is located in the cytoplasm. In rat, the protein associates with the 5.8S rRNA, very likely participates in the binding of aminoacyl-tRNA, and is a constituent of the elongation factor 2-binding site at the ribosomal subunit interface. Alternatively spliced transcript variants encoding the same protein exist. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2269
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
NBP3-05567
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-20216
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-81328
Species: Hu
Applications: ICC/IF, WB
MAB8164
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC
NBP2-20214
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00029956-M01A
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP1-31413
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-84037
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-20211
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-88582
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00026156-B01P
Species: Hu
Applications: ICC/IF, WB
H00028299-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-20210
Species: Hu, I, Mu
Applications: IHC, IHC-P, WB
NBP1-84744
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-88446
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00058516-B02P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00006124-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-82853
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-47297PEP
Species: Hu
Applications: AC

Publications for RPL8 Recombinant Protein Antigen (NBP2-47297PEP) (0)

There are no publications for RPL8 Recombinant Protein Antigen (NBP2-47297PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL8 Recombinant Protein Antigen (NBP2-47297PEP) (0)

There are no reviews for RPL8 Recombinant Protein Antigen (NBP2-47297PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RPL8 Recombinant Protein Antigen (NBP2-47297PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPL8 Products

Research Areas for RPL8 Recombinant Protein Antigen (NBP2-47297PEP)

Find related products by research area.

Blogs on RPL8

There are no specific blogs for RPL8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RPL7 Antibody
NB100-2269
LASS2 Antibody (1A6)
H00029956-M01A

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RPL8 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL8