Recombinant Human RPL39L Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RPL39L Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 51 of Human RPL39L full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
RPL39L
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RPL39L Protein

  • 60S ribosomal protein L39-like
  • L39-2
  • ribosomal protein L39-like 1,60S ribosomal protein L39-2
  • ribosomal protein L39-like protein
  • ribosomal protein L39-like
  • RPL39L1

Background

RPL39L( AAH12328, 1 a.a. - 52 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00140801-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-00612
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84744
Species: Hu
Applications: WB, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-82054
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16861
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00001164-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RPL39L Recombinant Protein (H00116832-P01) (0)

There are no publications for RPL39L Recombinant Protein (H00116832-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL39L Recombinant Protein (H00116832-P01) (0)

There are no reviews for RPL39L Recombinant Protein (H00116832-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPL39L Recombinant Protein (H00116832-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPL39L Products

Bioinformatics Tool for RPL39L Recombinant Protein (H00116832-P01)

Discover related pathways, diseases and genes to RPL39L Recombinant Protein (H00116832-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL39L Recombinant Protein (H00116832-P01)

Discover more about diseases related to RPL39L Recombinant Protein (H00116832-P01).
 

Pathways for RPL39L Recombinant Protein (H00116832-P01)

View related products by pathway.

PTMs for RPL39L Recombinant Protein (H00116832-P01)

Learn more about PTMs related to RPL39L Recombinant Protein (H00116832-P01).
 

Research Areas for RPL39L Recombinant Protein (H00116832-P01)

Find related products by research area.

Blogs on RPL39L

There are no specific blogs for RPL39L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RPL39L Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL39L