RPL36A Recombinant Protein Antigen

Images

 
There are currently no images for RPL36A Protein (NBP2-38036PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RPL36A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPL36A.

Source: E.coli

Amino Acid Sequence: MIAPTDSHEEVRSGTSYILPFASRFLSFRA

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RPL36A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38036.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for RPL36A Recombinant Protein Antigen

  • 60S ribosomal protein L36a
  • Cell growth-inhibiting gene 15 protein
  • Cell migration-inducing gene 6 protein
  • dJ164F3.3 (ribosomal protein L44)
  • L44L
  • L44-like ribosomal protein
  • MGC72020
  • MIG6,60S ribosomal protein L44
  • ribosomal protein L36a
  • ribosomal protein L44
  • RPL36AL
  • RPL44

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NBP2-16372
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81330
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-32311
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-56343
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC/IF, IP
NBP2-75649
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB100-2269
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
NBP2-20210
Species: Hu, Mu, I
Applications: WB, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for RPL36A Protein (NBP2-38036PEP) (0)

There are no publications for RPL36A Protein (NBP2-38036PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL36A Protein (NBP2-38036PEP) (0)

There are no reviews for RPL36A Protein (NBP2-38036PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RPL36A Protein (NBP2-38036PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional RPL36A Products

Bioinformatics Tool for RPL36A Protein (NBP2-38036PEP)

Discover related pathways, diseases and genes to RPL36A Protein (NBP2-38036PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL36A Protein (NBP2-38036PEP)

Discover more about diseases related to RPL36A Protein (NBP2-38036PEP).
 

Pathways for RPL36A Protein (NBP2-38036PEP)

View related products by pathway.

PTMs for RPL36A Protein (NBP2-38036PEP)

Learn more about PTMs related to RPL36A Protein (NBP2-38036PEP).

Blogs on RPL36A

There are no specific blogs for RPL36A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RPL36A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL36A