RPL35 Antibody

Images

 
Western Blot: RPL35 Antibody [NBP2-83470] - Host: Rabbit. Target Name: Rpl35. Sample Type: Mouse Small Intestine lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPL35 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Mouse RPL35. Peptide sequence: INQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLTKHEEKLKTKKQQRK The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
RPL35
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPL35 Antibody

  • M
  • ribosomal protein L35,60S ribosomal protein L35

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-93083
Species: Mu, Rt
Applications: WB
NBP3-12600
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
MAB7158
Species: Hu, Mu
Applications: IHC, WB
NBP2-20216
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-13251
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13255
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-94135
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-87847
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-47297
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-09260
Species: Hu
Applications: WB
NBP3-13045
Species: Hu
Applications: ICC/IF, WB
MAB8164
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC
NB100-2269
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
NBP1-31413
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-97838
Species: Hu
Applications: IHC, IHC-P, IP, WB
AF1197
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-13254
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-20687
Species: Hu
Applications: ICC/IF, WB
NBP2-87845
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-20210
Species: Hu, I, Mu
Applications: IHC, IHC-P, WB

Publications for RPL35 Antibody (NBP2-83470) (0)

There are no publications for RPL35 Antibody (NBP2-83470).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL35 Antibody (NBP2-83470) (0)

There are no reviews for RPL35 Antibody (NBP2-83470). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPL35 Antibody (NBP2-83470) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPL35 Products

Bioinformatics Tool for RPL35 Antibody (NBP2-83470)

Discover related pathways, diseases and genes to RPL35 Antibody (NBP2-83470). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL35 Antibody (NBP2-83470)

Discover more about diseases related to RPL35 Antibody (NBP2-83470).
 

Pathways for RPL35 Antibody (NBP2-83470)

View related products by pathway.

Blogs on RPL35

There are no specific blogs for RPL35, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL35 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL35