RPL30 Recombinant Protein Antigen

Images

 
There are currently no images for RPL30 Protein (NBP1-82855PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RPL30 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPL30.

Source: E. coli

Amino Acid Sequence: INSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGEK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RPL30
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82855.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RPL30 Recombinant Protein Antigen

  • 60S ribosomal protein L30
  • ribosomal protein L30

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30E family of ribosomal proteins. It is located in the cytoplasm. This gene is co-transcribed with the U72 small nucleolar RNA gene, which is located in its fourth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-12600
Species: Hu
Applications: ICC/IF, IHC-P, IP, WB
NBP3-25485
Species: Ca, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13251
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-20216
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP3-45266
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-31413
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-20210
Species: Hu, I, Mu, Ze
Applications: IHC-WhMt, IHC, IHC-P, WB
NBP2-20212
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-82853
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81328
Species: Hu
Applications: ICC/IF, WB
MAB8164
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC
NBP1-85385
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88446
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-2269
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
NBP1-80804
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00006143-M01
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-84843
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-94240
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-82855PEP
Species: Hu
Applications: AC

Publications for RPL30 Protein (NBP1-82855PEP) (0)

There are no publications for RPL30 Protein (NBP1-82855PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL30 Protein (NBP1-82855PEP) (0)

There are no reviews for RPL30 Protein (NBP1-82855PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RPL30 Protein (NBP1-82855PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPL30 Products

Research Areas for RPL30 Protein (NBP1-82855PEP)

Find related products by research area.

Blogs on RPL30.

New Primers Available for ChIP Procedures
Novus has recently released six new primer sets designed for use in real-time PCR DNA amplification of housekeeping, silent, or heterochromatin associated proteins. Specifically, the primers are for GAPDH, RPL30, MyoD1, AFM, alpha Satellite, and Satel...  Read full blog post.

Customers Who Bought This Also Bought

RPL7 Antibody
NB100-2269

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RPL30 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL30