Recombinant Human RPL27A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RPL27A Protein Summary

Description
RPL27A (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: HPGYFGKVGMKHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKSVGGACVLVA
Protein/Peptide Type
Partial Recombinant Protein
Gene
RPL27A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RPL27A Protein

  • 60S ribosomal protein L27a
  • FLJ43464
  • MGC10850
  • MGC17878
  • MGC87238
  • ribosomal protein L27a

Background

RPL27A - ribosomal protein L27a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00487
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-20212
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32572
Species: Hu
Applications: WB, IHC, IHC-P
H00055122-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP2-49581
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13254
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2277
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-57476
Species: Hu
Applications: WB, ICC/IF, IHC
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-11538
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-58885
Species: Hu
Applications: WB, ICC/IF
NB600-232
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP
H00006165-R01
Species: Hu
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-13263
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RPL27A Partial Recombinant Protein (H00006157-Q01) (0)

There are no publications for RPL27A Partial Recombinant Protein (H00006157-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL27A Partial Recombinant Protein (H00006157-Q01) (0)

There are no reviews for RPL27A Partial Recombinant Protein (H00006157-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPL27A Partial Recombinant Protein (H00006157-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPL27A Products

Bioinformatics Tool for RPL27A Partial Recombinant Protein (H00006157-Q01)

Discover related pathways, diseases and genes to RPL27A Partial Recombinant Protein (H00006157-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL27A Partial Recombinant Protein (H00006157-Q01)

Discover more about diseases related to RPL27A Partial Recombinant Protein (H00006157-Q01).
 

Pathways for RPL27A Partial Recombinant Protein (H00006157-Q01)

View related products by pathway.

PTMs for RPL27A Partial Recombinant Protein (H00006157-Q01)

Learn more about PTMs related to RPL27A Partial Recombinant Protein (H00006157-Q01).
 

Research Areas for RPL27A Partial Recombinant Protein (H00006157-Q01)

Find related products by research area.

Blogs on RPL27A

There are no specific blogs for RPL27A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HSP60 Antibody
NBP1-77397
HSP60 Antibody
NBP1-77397
HSP60 Antibody
NBP1-77397
RPL27A Antibody
NBP2-38025
RPL27A Antibody
NBP2-38025
RPL27A Antibody
NBP2-38025
SP1 Antibody
NB600-232
SP1 Antibody
NB600-232
SP1 Antibody
NB600-232

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RPL27A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL27A