RPL27A Partial Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

RPL27A Partial Recombinant Protein Summary

Description
RPL27A (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: HPGYFGKVGMKHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKSVGGACVLVA
Preparation
Method
in vitro wheat germ expression system
Gene
RPL27A

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RPL27A Partial Recombinant Protein

  • 60S ribosomal protein L27a
  • FLJ43464
  • MGC10850
  • MGC17878
  • MGC87238
  • ribosomal protein L27a

Background

RPL27A - ribosomal protein L27a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00487
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-20212
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32572
Species: Hu
Applications: WB, IHC, IHC-P
H00055122-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
H00006159-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13254
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2277
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-57476
Species: Hu
Applications: WB, ICC/IF, IHC
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-11538
Species: Hu, Mu, Rt
Applications: WB, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NBP1-80805
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NB600-232
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-13263
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RPL27A Partial Recombinant Protein (H00006157-Q01) (0)

There are no publications for RPL27A Partial Recombinant Protein (H00006157-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL27A Partial Recombinant Protein (H00006157-Q01) (0)

There are no reviews for RPL27A Partial Recombinant Protein (H00006157-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPL27A Partial Recombinant Protein (H00006157-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPL27A Partial Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for RPL27A Partial Recombinant Protein (H00006157-Q01)

Discover related pathways, diseases and genes to RPL27A Partial Recombinant Protein (H00006157-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL27A Partial Recombinant Protein (H00006157-Q01)

Discover more about diseases related to RPL27A Partial Recombinant Protein (H00006157-Q01).
 

Pathways for RPL27A Partial Recombinant Protein (H00006157-Q01)

View related products by pathway.

PTMs for RPL27A Partial Recombinant Protein (H00006157-Q01)

Learn more about PTMs related to RPL27A Partial Recombinant Protein (H00006157-Q01).
 

Research Areas for RPL27A Partial Recombinant Protein (H00006157-Q01)

Find related products by research area.

Blogs on RPL27A

There are no specific blogs for RPL27A, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol RPL27A

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00006157-Q01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

RPL27A Recombinant Protein
H00006157-P01-2ug
HSP60 Antibody
NBP1-77397
HSP60 Antibody
NBP1-77397
HSP60 Antibody
NBP1-77397
RPL27A Antibody
NBP2-37979
RPL27A Antibody
NBP2-37979
SP1 Antibody
NB600-232
SP1 Antibody
NB600-232
SP1 Antibody
NB600-232