RPL11 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RPL11 Antibody [NBP2-57808] - Staining of human cell line U-2 OS shows localization to vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPL11 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MAQDQGEKENPMRELRIRKLCLNICVGESGDRLTR
Specificity
Specificity of human RPL11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPL11
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RPL11 Recombinant Protein Antigen (NBP2-57808PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RPL11 Antibody

  • cell growth-inhibiting protein 34,60S ribosomal protein L11
  • CLL-associated antigen KW-12
  • DBA7
  • GIG34
  • ribosomal protein L11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82857
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00026156-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-84744
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2269
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
NBP3-05567
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-2736
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-75649
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-87847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7158
Species: Hu, Mu
Applications: WB, IHC
NBP1-81328
Species: Hu
Applications: WB, ICC/IF
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-57808
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for RPL11 Antibody (NBP2-57808) (0)

There are no publications for RPL11 Antibody (NBP2-57808).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL11 Antibody (NBP2-57808) (0)

There are no reviews for RPL11 Antibody (NBP2-57808). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RPL11 Antibody (NBP2-57808) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RPL11 Products

Bioinformatics Tool for RPL11 Antibody (NBP2-57808)

Discover related pathways, diseases and genes to RPL11 Antibody (NBP2-57808). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL11 Antibody (NBP2-57808)

Discover more about diseases related to RPL11 Antibody (NBP2-57808).
 

Pathways for RPL11 Antibody (NBP2-57808)

View related products by pathway.

PTMs for RPL11 Antibody (NBP2-57808)

Learn more about PTMs related to RPL11 Antibody (NBP2-57808).

Blogs on RPL11

There are no specific blogs for RPL11, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL11