RPGRIP1L Antibody

Images

 
Immunohistochemistry-Paraffin: RPGRIP1L Antibody [NBP1-84403] - Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPGRIP1L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KNTITLEVHQAYSTEYETIAACQLKFHEILEKSGRIFCTASLIGTKGDIPNFGTVEYWFRLRVPMDQAIRLYRERAKALGYITSNFKGPEHMQSLSQQAPKTAQLSSTDSTDGNL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPGRIP1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
ICC/IF reported in scientific literature (PMID: 26365165). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RPGRIP1L Protein (NBP1-84403PEP)
Publications
Read Publications using
NBP1-84403 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (87%). Reactivity reported in scientific literature (PMID: 23644468)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPGRIP1L Antibody

  • CORS3
  • FTMDKFZp686C0668
  • JBTS7fantom homolog
  • KIAA1005RPGRIP1-like protein
  • MKS5nephrocystin 8
  • NPHP8
  • protein fantom
  • RPGR-interacting protein 1-like protein
  • RPGRIP1-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-86991
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP1-06590
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP3-17404
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-55753
Species: Hu
Applications: IHC, IHC-P
NB110-60935
Species: Ch, Hu, Mu, Pm
Applications: IB, IHC, WB
NBP1-88692
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-93673
Species: Hu
Applications: IHC, IHC-P
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-15309
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92123
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP2-94059
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
1845-SH/CF
Species: Hu
Applications: BA
NBP2-33656
Species: Hu
Applications: IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBL1-17065
Species: Hu
Applications: WB
AF497
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-15463
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14126
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14279
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for RPGRIP1L Antibody (NBP1-84403)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for RPGRIP1L Antibody (NBP1-84403) (0)

There are no reviews for RPGRIP1L Antibody (NBP1-84403). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RPGRIP1L Antibody (NBP1-84403) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPGRIP1L Products

Bioinformatics Tool for RPGRIP1L Antibody (NBP1-84403)

Discover related pathways, diseases and genes to RPGRIP1L Antibody (NBP1-84403). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPGRIP1L Antibody (NBP1-84403)

Discover more about diseases related to RPGRIP1L Antibody (NBP1-84403).
 

Pathways for RPGRIP1L Antibody (NBP1-84403)

View related products by pathway.

PTMs for RPGRIP1L Antibody (NBP1-84403)

Learn more about PTMs related to RPGRIP1L Antibody (NBP1-84403).

Blogs on RPGRIP1L

There are no specific blogs for RPGRIP1L, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPGRIP1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPGRIP1L