RP2 Antibody - BSA Free

Western Blot: RP2 Antibody [NBP3-10108] - Western blot analysis of RP2 in Mouse Stomach lysates. Antibody dilution at 1ug/ml

Product Discontinued

RP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RP2 Antibody - BSA Free (NBP3-10108) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse RP2 (NP_001277572.1). Peptide sequence EEQPKLYSWDQREKVDPKDYMFSGLKDETVGRLPGKVAGQQFVIQDCENC
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 40 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RP2 Antibody - BSA Free

• DELXp11.3
• KIAA0215
• NME10
• protein XRP2
• retinitis pigmentosa 2 (X-linked recessive)
• TBCCD2
• XRP2

Background

The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding. Progressive retinal degeneration may therefore be due to the accumulation of incorrectly-folded photoreceptor or neuron-specific tubulin isoforms followed by progressive cell death

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RP2