Recombinant Human RNF213 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human RNF213 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2016-2112 of Human RNF213

Source: Wheat Germ

Amino Acid Sequence: LSPENAKLLSTFLNQTGLDAFLLELHEMIILKLKNPQTQTEERFRPQWSLRDTLVSYMQTKESEILPEMASQFPEEILLASCVSVWKTAAVLKWNRE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
RNF213
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RNF213 Protein

  • ALK lymphoma oligomerization partner on chromosome 17
  • C17orf27
  • chromosome 17 open reading frame 27
  • DKFZp762N1115
  • FLJ13051
  • KIAA1554MGC46622
  • KIAA1618
  • MGC9929
  • NET57
  • protein ALO17
  • ring finger protein 213

Background

C17orf27 - chromosome 17 open reading frame 27

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-57586
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56161
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-86624
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41206
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
MAB7357
Species: Hu
Applications: WB
AF4210
Species: Hu
Applications: WB, IHC
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45603
Species: Hu
Applications: WB, Flow, IHC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55515
Species: Hu
Applications: ICC/IF
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-55053
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-87486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88831
Species: Hu
Applications: WB, IHC, IHC-P
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91244
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00057674-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for RNF213 Partial Recombinant Protein (H00057674-Q01) (0)

There are no publications for RNF213 Partial Recombinant Protein (H00057674-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF213 Partial Recombinant Protein (H00057674-Q01) (0)

There are no reviews for RNF213 Partial Recombinant Protein (H00057674-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF213 Partial Recombinant Protein (H00057674-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RNF213 Products

Bioinformatics Tool for RNF213 Partial Recombinant Protein (H00057674-Q01)

Discover related pathways, diseases and genes to RNF213 Partial Recombinant Protein (H00057674-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF213 Partial Recombinant Protein (H00057674-Q01)

Discover more about diseases related to RNF213 Partial Recombinant Protein (H00057674-Q01).
 

Pathways for RNF213 Partial Recombinant Protein (H00057674-Q01)

View related products by pathway.

PTMs for RNF213 Partial Recombinant Protein (H00057674-Q01)

Learn more about PTMs related to RNF213 Partial Recombinant Protein (H00057674-Q01).
 

Research Areas for RNF213 Partial Recombinant Protein (H00057674-Q01)

Find related products by research area.

Blogs on RNF213

There are no specific blogs for RNF213, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
RNF213 Antibody
NBP1-88466
NPM1 Antibody
NB110-61646

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RNF213 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF213