Recombinant Human RNF2 Protein

Images

 
SDS-Page: RNF2 Recombinant Protein [H00006045-P01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RNF2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-336 of Human RNF2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
RNF2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RNF2 Protein

  • BAP-1
  • BAP1RING finger protein 1B
  • DING
  • DINGRING finger protein BAP-1
  • EC 6.3.2
  • HIPI3
  • HIPI3RING1BE3 ubiquitin-protein ligase RING2
  • Huntingtin-interacting protein 2-interacting protein 3
  • Protein DinG
  • ring finger protein 2HIP2-interacting protein 3
  • RING1B
  • RING2
  • RING2EC 6.3.2.-
  • RNF2

Background

Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37370
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6008
Species: Hu, Mu, Rt
Applications: WB
NBP1-33748
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
AF5827
Species: Hu, Mu
Applications: WB
NB100-68209
Species: Hu, Mu
Applications: WB, IP, PLA
21650002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-29965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006045-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for RNF2 Recombinant Protein (H00006045-P01) (0)

There are no publications for RNF2 Recombinant Protein (H00006045-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF2 Recombinant Protein (H00006045-P01) (0)

There are no reviews for RNF2 Recombinant Protein (H00006045-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF2 Recombinant Protein (H00006045-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RNF2 Products

Bioinformatics Tool for RNF2 Recombinant Protein (H00006045-P01)

Discover related pathways, diseases and genes to RNF2 Recombinant Protein (H00006045-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF2 Recombinant Protein (H00006045-P01)

Discover more about diseases related to RNF2 Recombinant Protein (H00006045-P01).
 

Pathways for RNF2 Recombinant Protein (H00006045-P01)

View related products by pathway.

PTMs for RNF2 Recombinant Protein (H00006045-P01)

Learn more about PTMs related to RNF2 Recombinant Protein (H00006045-P01).
 

Research Areas for RNF2 Recombinant Protein (H00006045-P01)

Find related products by research area.

Blogs on RNF2

There are no specific blogs for RNF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
RNF2 Antibody (3G6)
H00006045-M03

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RNF2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF2
Entrez