RNF169 Antibody

Images

 
Immunohistochemistry-Paraffin: RNF169 Antibody [NBP2-13239] - Staining of human oral mucosa shows moderate nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF169 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GSGTSLEREQFEGLGSTPDAKLDKTCISRAMKITTVNSVLPQNSVLGGVL KTKQQLKTLNHFDLTNGVLVESLSEEPLPSLRRGRKRHCKTKHLEQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF169
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RNF169 Protein (NBP2-13239PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RNF169 Antibody

  • EC 3.4.24.57
  • KIAA1991EC 3.1.4.16
  • ring finger protein 169

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7217
Species: Hu, Mu
Applications: WB, ICC
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP1-87156
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009025-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00056852-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-81988
Species: Hu
Applications: IHC, IHC-P

Publications for RNF169 Antibody (NBP2-13239) (0)

There are no publications for RNF169 Antibody (NBP2-13239).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF169 Antibody (NBP2-13239) (0)

There are no reviews for RNF169 Antibody (NBP2-13239). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RNF169 Antibody (NBP2-13239) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF169 Products

Bioinformatics Tool for RNF169 Antibody (NBP2-13239)

Discover related pathways, diseases and genes to RNF169 Antibody (NBP2-13239). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF169 Antibody (NBP2-13239)

Discover more about diseases related to RNF169 Antibody (NBP2-13239).
 

Pathways for RNF169 Antibody (NBP2-13239)

View related products by pathway.

Research Areas for RNF169 Antibody (NBP2-13239)

Find related products by research area.

Blogs on RNF169

There are no specific blogs for RNF169, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF169 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF169