RNF125 Recombinant Protein Antigen

Images

 
There are currently no images for RNF125 Protein (NBP1-83653PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RNF125 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RNF125.

Source: E.coli

Amino Acid Sequence: CIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCVCP

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RNF125
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83653.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for RNF125 Recombinant Protein Antigen

  • E3 ubiquitin-protein ligase RNF125
  • EC 6.3.2.-
  • FLJ20456
  • MGC21737
  • ring finger protein 125TRAC1
  • T-cell RING activation protein 1
  • T-cell ring protein identified in activation screen
  • TRAC-1

Background

RNF125 encodes a novel E3 ubiquitin ligase that contains an N-terminal RING finger domain. The encoded protein may function as a positive regulator in the T-cell receptor signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4859
Species: Hu
Applications: WB
NB100-58824
Species: Hu, Mu
Applications: CHIP-SEQ, ChIP, IP, WB
NB110-1244
Species: Hu, Mu, Pm
Applications: Flow, IHC, IHC-P, PEP-ELISA
NBP1-87204
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-80859
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-98549
Species: Hu
Applications: WB
NBP1-85348
Species: Hu
Applications: IHC, IHC-P, WB
UL-553
Species: Hu
Applications: EnzAct
NBP1-04351
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP2-88163
Species: Hu
Applications: WB
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
NBP1-92151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-83653PEP
Species: Hu
Applications: AC

Publications for RNF125 Protein (NBP1-83653PEP) (0)

There are no publications for RNF125 Protein (NBP1-83653PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF125 Protein (NBP1-83653PEP) (0)

There are no reviews for RNF125 Protein (NBP1-83653PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RNF125 Protein (NBP1-83653PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RNF125 Products

Array NBP1-83653PEP

Bioinformatics Tool for RNF125 Protein (NBP1-83653PEP)

Discover related pathways, diseases and genes to RNF125 Protein (NBP1-83653PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF125 Protein (NBP1-83653PEP)

Discover more about diseases related to RNF125 Protein (NBP1-83653PEP).
 

Pathways for RNF125 Protein (NBP1-83653PEP)

View related products by pathway.

PTMs for RNF125 Protein (NBP1-83653PEP)

Learn more about PTMs related to RNF125 Protein (NBP1-83653PEP).
 

Research Areas for RNF125 Protein (NBP1-83653PEP)

Find related products by research area.

Blogs on RNF125

There are no specific blogs for RNF125, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Rhodopsin Antibody (4D2)
NBP2-59690-100ug

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RNF125 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF125