RKIP/PBP Recombinant Protein Antigen

Images

 
There are currently no images for RKIP/PBP Protein (NBP1-89711PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RKIP/PBP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PEBP1.

Source: E. coli

Amino Acid Sequence: PTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PEBP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89711.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RKIP/PBP Recombinant Protein Antigen

  • HCNP
  • HCNPpp
  • hippocampal cholinergic neurostimulating peptide
  • Neuropolypeptide h3
  • PBP
  • PBPPEBP-1
  • PEBP1
  • PEBP-1
  • PEBPHCNPpp
  • phosphatidylethanolamine binding protein 1
  • phosphatidylethanolamine-binding protein 1
  • prostatic binding protein
  • Prostatic-binding protein
  • Raf kinase inhibitory protein
  • RKIP
  • RKIPRaf kinase inhibitor protein

Background

PBP, also known as RKIP (RAF kinase inhibitor protein), binds ATP, opioids and phosphatidylethanolamine. PBP is able to regulate Aurora kinase B expression and the spindle checkpoint through interaction with the RAF1/MEK/ERK cascade. PBP is able to bind to RAF1 and MEK and competitively disrupt the interaction between these proteins. PBP may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. It increases the production of choline acetyltransferase but not acetylcholinesterase. PBP has been implicated as a suppressor of metastasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4540
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-82956
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-51671
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MAB4218
Species: Hu
Applications: IHC, WB
DY393
Species: Hu
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB100-2574
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-31528
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-89711PEP
Species: Hu
Applications: AC

Publications for RKIP/PBP Protein (NBP1-89711PEP) (0)

There are no publications for RKIP/PBP Protein (NBP1-89711PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RKIP/PBP Protein (NBP1-89711PEP) (0)

There are no reviews for RKIP/PBP Protein (NBP1-89711PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RKIP/PBP Protein (NBP1-89711PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RKIP/PBP Products

Research Areas for RKIP/PBP Protein (NBP1-89711PEP)

Find related products by research area.

Blogs on RKIP/PBP

There are no specific blogs for RKIP/PBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RKIP/PBP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PEBP1