Rit2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Rit2 Source: E.coli
Amino Acid Sequence: LVREIRKKESMPSLMEKKLKRKDSLWKKLKGSLKKKR Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
RIT2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25106It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Rit2 Recombinant Protein Antigen
Background
RIT2 is a gene that codes for a protein which binds and exchanges GTP and GDP, and has two isoforms with lengths of 217 and 153 amino acids, with weights of approximately 25 and 17 kDa, respectively. Current studies are being done on diseases and disorders relating to this gene including neuronitis, ehrlichiosis, cryoglobulinemia, hepatitis, Parkinson's disease, and schizophrenia. RIT2 has been shown to have interactions with CALM1, CALM2, CALM3, RLF, and HRAS in pathways such as the Trk receptor signaling, signaling to NGF, and signaling to ERKs pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
Species: Bv, Hu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: AC
Publications for Rit2 Recombinant Protein Antigen (NBP3-25106PEP) (0)
There are no publications for Rit2 Recombinant Protein Antigen (NBP3-25106PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Rit2 Recombinant Protein Antigen (NBP3-25106PEP) (0)
There are no reviews for Rit2 Recombinant Protein Antigen (NBP3-25106PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Rit2 Recombinant Protein Antigen (NBP3-25106PEP) (0)
Additional Rit2 Products
Research Areas for Rit2 Recombinant Protein Antigen (NBP3-25106PEP)
Find related products by research area.
|
Blogs on Rit2