We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Rit2 Recombinant Protein Antigen

Images

 
There are currently no images for Rit2 Recombinant Protein Antigen (NBP3-25106PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Rit2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Rit2

Source: E.coli

Amino Acid Sequence: LVREIRKKESMPSLMEKKLKRKDSLWKKLKGSLKKKR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
RIT2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25106It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Rit2 Recombinant Protein Antigen

  • GTP-binding protein Rit2
  • GTP-binding protein Roc2
  • Ras-like protein expressed in neurons
  • Ras-like without CAAX 2
  • Ras-like without CAAX protein 2
  • RIBA
  • Ric (Drosophila)-like, expressed in neurons
  • Ric-like, expressed in neurons
  • RIN
  • Rit2
  • ROC2

Background

RIT2 is a gene that codes for a protein which binds and exchanges GTP and GDP, and has two isoforms with lengths of 217 and 153 amino acids, with weights of approximately 25 and 17 kDa, respectively. Current studies are being done on diseases and disorders relating to this gene including neuronitis, ehrlichiosis, cryoglobulinemia, hepatitis, Parkinson's disease, and schizophrenia. RIT2 has been shown to have interactions with CALM1, CALM2, CALM3, RLF, and HRAS in pathways such as the Trk receptor signaling, signaling to NGF, and signaling to ERKs pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4697
Species: Hu
Applications: WB
NBP1-85594
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-20113
Species: Hu, Mu
Applications: ICC/IF, WB
NB110-68800
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
NB100-2385
Species: Bv, Hu, Po
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB59151
Species: Mu
Applications: WB
NBP2-21037
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC,  IHC-P
NBP2-67702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-25106PEP
Species: Hu
Applications: AC

Publications for Rit2 Recombinant Protein Antigen (NBP3-25106PEP) (0)

There are no publications for Rit2 Recombinant Protein Antigen (NBP3-25106PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rit2 Recombinant Protein Antigen (NBP3-25106PEP) (0)

There are no reviews for Rit2 Recombinant Protein Antigen (NBP3-25106PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Rit2 Recombinant Protein Antigen (NBP3-25106PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Rit2 Products

Research Areas for Rit2 Recombinant Protein Antigen (NBP3-25106PEP)

Find related products by research area.

Blogs on Rit2

There are no specific blogs for Rit2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Rit2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RIT2