RILPL1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RILPL1 Antibody [NBP1-81928] - Staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RILPL1 Antibody [NBP1-81928] - Staining of human skin shows weak cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: RILPL1 Antibody [NBP1-81928] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: RILPL1 Antibody [NBP1-81928] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells and weak membranous staining of glandular cells.

Immunohistochemistry-Paraffin: RILPL1 Antibody [NBP1-81928] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RILPL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RILPL1 Antibody - BSA Free (NBP1-81928) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-RILPL1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LELDRLRLERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLSHKDVNFSEEEFQKHEGMSERERQVMKKLKEV
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RILPL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RILPL1 Protein (NBP1-81928PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22253135)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RILPL1 Antibody - BSA Free

• FLJ39378
• MGC105128
• MGC99793
• Rab interacting lysosomal protein-like 1
• Rab-interacting lysosomal-like protein 1
• RILP-like protein 1

Background

Does not regulate lysosomal morphology and distribution

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RILPL1 Antibody (NBP1-81928)(2)

Publications using NBP1-81928

• Schaub JR, Stearns T. The Rilp-like proteins Rilpl1 and Rilpl2 regulate ciliary membrane content. Mol Biol Cell. 2012-12-21 [PMID: 23264467]
• Li A, Ponten F, dos Remedios CG. The interactome of LIM domain proteins: the contributions of LIM domain proteins to heart failure and heart development. Proteomics 2012-01-01 [PMID: 22253135]

Bioinformatics

• Gene Symbol: RILPL1