RILPL1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RILPL1 Antibody [NBP1-81928] - Staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RILPL1 Antibody [NBP1-81928] - Staining of human skin shows weak cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: RILPL1 Antibody [NBP1-81928] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: RILPL1 Antibody [NBP1-81928] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells and weak membranous staining of glandular cells.
Immunohistochemistry-Paraffin: RILPL1 Antibody [NBP1-81928] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RILPL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LELDRLRLERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLSHKDVNFSEEEFQKHEGMSERERQVMKKLKEV
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RILPL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RILPL1 Protein (NBP1-81928PEP)
Publications
Read Publications using NBP1-81928.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22253135)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RILPL1 Antibody

  • FLJ39378
  • MGC105128
  • MGC99793
  • Rab interacting lysosomal protein-like 1
  • Rab-interacting lysosomal-like protein 1
  • RILP-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-148
Species: Ce, Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-33116
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87174
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-98957
Species: Hu
Applications: ICC/IF, IHC, IP, RIA, WB
NBP1-82041
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00338382-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB100-181
Species: Hu, Mu
Applications: IP, WB
NBP2-02667
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-85576
Species: Hu
Applications: WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, WB

Publications for RILPL1 Antibody (NBP1-81928)(2)

Reviews for RILPL1 Antibody (NBP1-81928) (0)

There are no reviews for RILPL1 Antibody (NBP1-81928). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RILPL1 Antibody (NBP1-81928) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RILPL1 Products

Bioinformatics Tool for RILPL1 Antibody (NBP1-81928)

Discover related pathways, diseases and genes to RILPL1 Antibody (NBP1-81928). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on RILPL1

There are no specific blogs for RILPL1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RILPL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RILPL1