RIC8A Antibody

Images

 
Western Blot: RIC8 Antibody [NBP1-57011] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RIC8A Antibody Summary

Immunogen
Synthetic peptides corresponding to RIC8A (resistance to inhibitors of cholinesterase 8 homolog A (C. elegans)) The peptide sequence was selected from the N terminal of RIC8A. Peptide sequence KLTERVGLYRERSFPHDVQFFDLRLLFLLTALRTDVRQQLFQELKG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RIC8A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RIC8A and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RIC8A Antibody

  • RIC8
  • RIC8A resistance to inhibitors of cholinesterase 8 homolog A (C. elegans)
  • synembryn
  • synembryn-A

Background

RIC8A is a guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins.RIC8A is able to activate GNAI1, GNAO1 and GNAQ, but not GNAS by exchanging bound GDP for free GTP.RIC8A is involved in regulation of microtubule pulling forces during mitotic movement of chromosomes by stimulating G(i)-alpha protein, possibly leading to release G(i)-alpha-GTP and NuMA proteins from the NuMA-GPSM2-G(i)-alpha-GDP complex. RIC8A also acts as an activator for G(q)-alpha (GNAQ) protein by enhancing the G(q)-coupled receptor-mediated ERK activation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-13232
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56179
Species: Hu
Applications: ICC/IF
NBP1-91968
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
NLS2756
Species: Hu, Mk
Applications: IHC-P, ICC
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NLS1014
Species: Hu, Mu, Rt, Bt, Bv, Ca, Eq, Ha, Mk, Pm
Applications: IHC-P
H00442206-R02
Species: Hu
NBP1-57011
Species: Hu
Applications: WB

Publications for RIC8A Antibody (NBP1-57011) (0)

There are no publications for RIC8A Antibody (NBP1-57011).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIC8A Antibody (NBP1-57011) (0)

There are no reviews for RIC8A Antibody (NBP1-57011). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RIC8A Antibody (NBP1-57011) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RIC8A Antibody (NBP1-57011)

Discover related pathways, diseases and genes to RIC8A Antibody (NBP1-57011). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RIC8A Antibody (NBP1-57011)

Discover more about diseases related to RIC8A Antibody (NBP1-57011).
 

Pathways for RIC8A Antibody (NBP1-57011)

View related products by pathway.

Blogs on RIC8A

There are no specific blogs for RIC8A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RIC8A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RIC8A
Uniprot