RIC3 Antibody

Images

 
Western Blot: RIC3 Antibody [H00079608-B01P] - Analysis of RIC3 expression in transfected 293T cell line by RIC3 polyclonal antibody. Lane 1: RIC3 transfected lysate(40.48 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, ChHa, XpSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RIC3 Antibody Summary

Immunogen
RIC3 (NP_078833.2, 1 a.a. - 368 a.a.) full-length human protein. MAYSTVQRVALASGLVLALSLLLPKAFLSRGKRQEPPPTPEGKLGRFPPMMHHHQAHSDGQTPGARFQRSHLAEAFAKAKGSGGGAGGGGSGRGLMGQIIPIYGFGIFLYILYILFKLSKGKTTAEDGKCYTAMPGNTHRKITSFELAQLQEKLKETEAAMEKLFNRVGPNGERAQTVTSDQEKRLLHQLREITRVMKEGKFIDRFSPEKEAEEAPYMEDWEGYPEETYPIYDLSDCIKRRQETILVDYPDPKELSAEEIAERMGMIEEEESDHLGWESLPTDPRAQEDNSVTSCDPKPETCSCCFHEDEDPAVLAENAGFSADSYPEQEETTKEEWSQDFKDEGLGISTDKAYTGSMLRKRNPQGLE
Specificity
Reacts with resistance to inhibitors of cholinesterase 3 homolog (C. elegans).
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
RIC3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This antibody is reactive against transfected lysate in western blot.
Reviewed Applications
Read 1 Review rated 3
using
H00079608-B01P in the following application:

Publications
Read Publications using
H00079608-B01P in the following applications:

  • WB
    1 publication

Reactivity Notes

Customer Review indicates reactivity in both CHO K1 Cell lines and Frog oocytes.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RIC3 Antibody

  • AYST720
  • FLJ11608
  • PRO1385
  • protein RIC-3
  • resistance to inhibitors of cholinesterase 3 homolog (C. elegans)

Background

RIC3 is a protein associated with nicotinic acetylcholine receptors (nAChRs), neurotransmitter-gated ion channels expressed at the neuromuscular junction and within the central and peripheral nervous systems, that can enhance functional expression of multiple nAChR subtypes (Lansdell et al., 2005 [PubMed 16120769]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61674
Species: Hu
Applications: ELISA, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP1-88769
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-82486
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56351
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
NBP2-61660
Species: Hu
Applications: ELISA, Flow, WB
640-A3
Species: Mu
Applications: Bind
NBP1-84999
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-20758
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88071
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP3-09392
Species: Hu, Mu
Applications: WB
NBP2-61787
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NLS1049
Species: Eq, Hu, Pm, Po, Pm
Applications: ICC, ICC/IF, IHC, IHC-P
NBP1-59631
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for RIC3 Antibody (H00079608-B01P)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for RIC3 Antibody (H00079608-B01P) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Other.

Reviews using H00079608-B01P:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Other
(1)
All Species
Images Ratings Applications Species Date Details
  3
reviewed by:
Verified Customer
WB Other 03/22/2010
View

Summary

ApplicationWestern Blot
Sample TestedCHO K1 Cell lines/ Frog oocytes
SpeciesOther
Lot09135WULz

Blocking

Blocking DetailsBlocking Buffer: 5% Milk (non-fat), Blocking Time: 1 hour, Blocking Temp: 25 degrees Celsius

Primary Anitbody

Dilution RatioDilution Ratio: 1/500, Incubation Dilution Buffer: 5% milk, Incubation Time: overnight, Incubation Temp: 4 C

Secondary Antibody

Secondary DescriptionSecondary Ab: Thermo Scientific Goat Anti-Mouse IgG (H+L), Secondary Ab Dilution Ratio: 1/50000

Details

Detection NotesMethod:ECL, Time:20min, NegCtrl:Mammalian nontransfected cells/Uninjected oocytes, Band:60kDa(specific), 100kDa(non-specific)

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RIC3 Antibody (H00079608-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

 
Verified Customer
03/22/2010
Application: WB
Species: Other

Bioinformatics

Gene Symbol RIC3
Entrez
Uniprot