RIC3 Antibody - Azide and BSA Free

Western Blot: RIC3 Antibody [H00079608-B01P] - Analysis of RIC3 expression in transfected 293T cell line by RIC3 polyclonal antibody. Lane 1: RIC3 transfected lysate(40.48 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu, ChHa, Xp
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RIC3 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse RIC3 Antibody - Azide and BSA Free (H00079608-B01P) is a polyclonal antibody validated for use in WB. Anti-RIC3 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: RIC3 (NP_078833.2, 1 a.a. - 368 a.a.) full-length human protein. MAYSTVQRVALASGLVLALSLLLPKAFLSRGKRQEPPPTPEGKLGRFPPMMHHHQAHSDGQTPGARFQRSHLAEAFAKAKGSGGGAGGGGSGRGLMGQIIPIYGFGIFLYILYILFKLSKGKTTAEDGKCYTAMPGNTHRKITSFELAQLQEKLKETEAAMEKLFNRVGPNGERAQTVTSDQEKRLLHQLREITRVMKEGKFIDRFSPEKEAEEAPYMEDWEGYPEETYPIYDLSDCIKRRQETILVDYPDPKELSAEEIAERMGMIEEEESDHLGWESLPTDPRAQEDNSVTSCDPKPETCSCCFHEDEDPAVLAENAGFSADSYPEQEETTKEEWSQDFKDEGLGISTDKAYTGSMLRKRNPQGLE
• Specificity: Reacts with resistance to inhibitors of cholinesterase 3 homolog (C. elegans).
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: RIC3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
• Application Notes: This antibody is reactive against transfected lysate in western blot.

Reactivity Notes

Customer Review indicates reactivity in both CHO K1 Cell lines and Frog oocytes.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RIC3 Antibody - Azide and BSA Free

• AYST720
• FLJ11608
• PRO1385
• protein RIC-3
• resistance to inhibitors of cholinesterase 3 homolog (C. elegans)

Background

RIC3 is a protein associated with nicotinic acetylcholine receptors (nAChRs), neurotransmitter-gated ion channels expressed at the neuromuscular junction and within the central and peripheral nervous systems, that can enhance functional expression of multiple nAChR subtypes (Lansdell et al., 2005 [PubMed 16120769]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RIC3 Antibody (H00079608-B01P)(3)

Publications using H00079608-B01P

• Hoa D, Michaela J Binding motif for RIC-3 chaperon protein in serotonin type 3A receptors. J Gen Physiol. 2023-04-07 [PMID: 37026993]
• Deshpande A, Vinayakamoorthy Rm, Garg Bk et Al. Why Does Knocking Out NACHO, But Not RIC3, Completely Block Expression of alpha 7 Nicotinic Receptors in Mouse Brain? Biomolecules 2020-03-19 [PMID: 32204458]
• Nishtala S, Mnatsakanyan N, Pandhare A et al. Direct interaction of the resistance to inhibitors of cholinesterase type 3 protein with the serotonin receptor type 3A intracellular domain. J Neurochem. [PMID: 26875553] (WB, Human)

Review for RIC3 Antibody (H00079608-B01P) (1)

Average Rating: 3

(Based on 1 review)

We have 1 review tested in 1 species: Other.

reviewed by: Verified Customer WB Other 03/22/2010

Summary

• Application: Western Blot
• Sample Tested: CHO K1 Cell lines/ Frog oocytes
• Species: Other
• Lot: 09135WULz

Bioinformatics

• Gene Symbol: RIC3
• Entrez:
  • 79608(Human)
• Uniprot:
  • NP_078833.2(Human)