RGS20 Antibody

Images

 
Western Blot: RGS20 Antibody [NBP1-54839] - HepG2 cell lysate, concentration 5.0ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RGS20 Antibody Summary

Immunogen
Synthetic peptides corresponding to RGS20 (regulator of G-protein signalling 20) The peptide sequence was selected from the N terminal of RGS20. Peptide sequence KHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RGS20
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RGS20 and was validated on Western blot.
Theoretical MW
44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RGS20 Antibody

  • G(z)GAP
  • Gz-GAP
  • Gz-selective GTPase-activating protein
  • regulator of G-protein signaling 20
  • Regulator of G-protein signaling Z1
  • regulator of G-protein signalling 20
  • Regulator of Gz-selective protein signaling 1
  • RGSZ1g(z)GAP
  • ZGAP1gz-GAP

Background

Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins are GTPase-activating proteins for Gi and Gq class G-alpha proteins. They accelerate transit through the cycle of GTP binding and hydrolysis and thereby accelerate signaling kinetics and termination.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24516
Species: Hu, Mu
Applications: WB, IHC-P
NBP1-33694
Species: Hu
Applications: WB, ICC/IF
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88111
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49461
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, In vivo
NB100-1353
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-83257
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86020
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00006000-B01P
Species: Hu, Rt
Applications: WB, Flow
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-1029
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA

Publications for RGS20 Antibody (NBP1-54839) (0)

There are no publications for RGS20 Antibody (NBP1-54839).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS20 Antibody (NBP1-54839) (0)

There are no reviews for RGS20 Antibody (NBP1-54839). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RGS20 Antibody (NBP1-54839) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RGS20 Products

Bioinformatics Tool for RGS20 Antibody (NBP1-54839)

Discover related pathways, diseases and genes to RGS20 Antibody (NBP1-54839). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS20 Antibody (NBP1-54839)

Discover more about diseases related to RGS20 Antibody (NBP1-54839).
 

Pathways for RGS20 Antibody (NBP1-54839)

View related products by pathway.

PTMs for RGS20 Antibody (NBP1-54839)

Learn more about PTMs related to RGS20 Antibody (NBP1-54839).
 

Research Areas for RGS20 Antibody (NBP1-54839)

Find related products by research area.

Blogs on RGS20

There are no specific blogs for RGS20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RGS20 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RGS20
Uniprot