RGS13 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit RGS13 Antibody - BSA Free (NBP3-17112) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: TYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RGS13 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for RGS13 Antibody - BSA Free
Background
RGS13 is encoded by this gene is a member of the regulator of G protein signaling (RGS) family. RGS family members share similarity with S. cerevisiae SST2 and C. elegans egl-10 proteins, which contain a characteristic conserved RGS domain. RGS proteins accelerate GTPase activity of G protein alpha-subunits, thereby driving G protein into their inactive GDP-bound form, thus negatively regulating G protein signaling. RGS proteins have been implicated in the fine tuning of a variety of cellular events in response to G protein-coupled receptor activation. The biological function of this gene, however, is unknown. Two transcript variants encoding the same isoform exist.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, KD, WB
Species: Fe, Hu, RM
Applications: BA, BA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Mu
Applications: IHC, Neut, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: IHC
Publications for RGS13 Antibody (NBP3-17112) (0)
There are no publications for RGS13 Antibody (NBP3-17112).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RGS13 Antibody (NBP3-17112) (0)
There are no reviews for RGS13 Antibody (NBP3-17112).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for RGS13 Antibody (NBP3-17112) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RGS13 Products
Research Areas for RGS13 Antibody (NBP3-17112)
Find related products by research area.
|
Blogs on RGS13