RGS10 Antibody

Images

 
Western Blot: RGS10 Antibody [NBP1-55396] - Bone marrow derived monocytes, Antibody Titration: 0.2-1 ug/ml
Flow Cytometry: RGS10 Antibody [NBP1-55396] - bone marrow derived monocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Flow, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RGS10 Antibody Summary

Immunogen
Synthetic peptides corresponding to RGS10 (regulator of G-protein signalling 10) The peptide sequence was selected from the middle region of RGS10. Peptide sequence DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RGS10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Flow Cytometry 1:10-1:1000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against RGS10 and was validated on Western blot.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RGS10 Antibody

  • regulator of G-protein signaling 10
  • regulator of G-protein signalling 10

Background

RGS10 inhibits signal transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. It associates specifically with the activated forms of the G protein subunits G(I)-ALPHA and G(Z)- alpha but fails to interact with the structurally and functionally distinct G(S)-alpha subunit. Activity on G(Z)-alpha is inhibited by palmitoylation of the G-protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24516
Species: Hu, Mu
Applications: WB, IHC-P
H00005998-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-56734
Species: Hu
Applications: WB
H00006000-B01P
Species: Hu, Rt
Applications: WB, Flow
NBP2-01584
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-58919
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20148
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24945
Species: Hu, Mu, Rt, Po, Ca, Pm
Applications: WB
H00008601-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NLS418
Species: Hu
Applications: IHC-P
NB100-1029
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P

Publications for RGS10 Antibody (NBP1-55396) (0)

There are no publications for RGS10 Antibody (NBP1-55396).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS10 Antibody (NBP1-55396) (0)

There are no reviews for RGS10 Antibody (NBP1-55396). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RGS10 Antibody (NBP1-55396) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RGS10 Products

Bioinformatics Tool for RGS10 Antibody (NBP1-55396)

Discover related pathways, diseases and genes to RGS10 Antibody (NBP1-55396). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS10 Antibody (NBP1-55396)

Discover more about diseases related to RGS10 Antibody (NBP1-55396).
 

Pathways for RGS10 Antibody (NBP1-55396)

View related products by pathway.

PTMs for RGS10 Antibody (NBP1-55396)

Learn more about PTMs related to RGS10 Antibody (NBP1-55396).

Blogs on RGS10

There are no specific blogs for RGS10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RGS10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RGS10
Uniprot