RGS1 Antibody

Images

 
Western Blot: RGS1 Antibody [NBP2-82338] - Host: Rabbit. Target Name: RGS1. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RGS1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human RGS1. Peptide sequence: LKGTTHSLLDDKMQKRRPKTFGMDMKAYLRSMIPHLESGMKSSKSKDVLS The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
RGS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RGS1 Antibody

  • 1R20
  • 1R20Early response protein 1R20
  • B-cell activation protein BL34
  • BL34
  • Early response protein 1R20
  • HEL-S-87
  • IER1
  • IR20
  • IR20immediate-early response 1, B-cell specific
  • regulator of G-protein signaling 1
  • regulator of G-protein signalling 1
  • RGS1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005997-M01
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, KD, WB
NBP2-01584
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-24516
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-32728
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-94071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NLS418
Species: Hu
Applications: IHC, IHC-P
NLS2756
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NLS1017
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
NLS2576
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
H00005998-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
NBP2-24417
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-00880
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
419-ML/CF
Species: Mu
Applications: BA
NBP2-82338
Species: Hu
Applications: WB

Publications for RGS1 Antibody (NBP2-82338) (0)

There are no publications for RGS1 Antibody (NBP2-82338).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS1 Antibody (NBP2-82338) (0)

There are no reviews for RGS1 Antibody (NBP2-82338). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RGS1 Antibody (NBP2-82338) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RGS1 Products

Bioinformatics Tool for RGS1 Antibody (NBP2-82338)

Discover related pathways, diseases and genes to RGS1 Antibody (NBP2-82338). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS1 Antibody (NBP2-82338)

Discover more about diseases related to RGS1 Antibody (NBP2-82338).
 

Pathways for RGS1 Antibody (NBP2-82338)

View related products by pathway.

PTMs for RGS1 Antibody (NBP2-82338)

Learn more about PTMs related to RGS1 Antibody (NBP2-82338).
 

Research Areas for RGS1 Antibody (NBP2-82338)

Find related products by research area.

Blogs on RGS1

There are no specific blogs for RGS1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RGS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RGS1