Home » RGS1 » RGS1 Antibodies » RGS1 Antibody

RGS1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: RGS1 Antibody [NBP2-82338] - Host: Rabbit. Target Name: RGS1. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml
Western Blot: RGS1 Antibody [NBP2-82338] - Host: Rabbit. Target Name: RGS1. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

RGS1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human RGS1. Peptide sequence: LKGTTHSLLDDKMQKRRPKTFGMDMKAYLRSMIPHLESGMKSSKSKDVLS The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
RGS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RGS1 Antibody

  • 1R20
  • 1R20Early response protein 1R20
  • B-cell activation protein BL34
  • BL34
  • Early response protein 1R20
  • HEL-S-87
  • IER1
  • IR20
  • IR20immediate-early response 1, B-cell specific
  • regulator of G-protein signaling 1
  • regulator of G-protein signalling 1
  • RGS1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RGS2 Antibody (4C4)
H00005997-M01
Western Blot: RGS2 Antibody (4C4) [H00005997-M01] - RGS2 monoclonal antibody (M01), clone 4C4 Analysis of RGS2 expression in MCF-7.
Knockdown Validated: RGS2 Antibody (4C4) [H00005997-M01] - Knockdown efficiencies of target proteins in HEK293 cells measured by Reverse Phase Protein Array (RPPA) and Western blotting (WB). Level of expression by WB and RPPA of targeted proteins in HEK293 cells transfected with siRNA targeting proteins of interest or non-silencing siRNA control (siCTR). Specific bands for WB and spots corresponding to the dilution of the dynamic range in RPPA are presented. Image collected and cropped by CiteAb from the following publication (http://rbej.biomedcentral.com/articles/10.1186/1477-7827-11-100) licensed under a CC-BY licence.
Western Blot: RGS2 Antibody (4C4) [H00005997-M01] - Specificity of antibodies. HEK293 cells lysates were analysed by Western blotting to test the specificity of antibodies. Image collected and cropped by CiteAb from the following publication (http://rbej.biomedcentral.com/articles/10.1186/1477-7827-11-100) licensed under a CC-BY licence.
(6 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, KD, WB
RGS16 Antibody
(OTI4E5)
NBP2-01584
Flow Cytometry: RGS16 Antibody (OTI4E5) [NBP2-01584] - Analysis of Jurkat cells, using anti-RGS16 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Western Blot: RGS16 Antibody (OTI4E5) [NBP2-01584] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RGS16 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-RGS16.
Immunohistochemistry-Paraffin: RGS16 Antibody (OTI4E5) [NBP2-01584] - Staining of paraffin-embedded Human breast tissue using anti-RGS16 mouse monoclonal antibody.
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
RGS19 Antibody
NBP2-24516
Immunohistochemistry-Paraffin: RGS19 Antibody [NBP2-24516] - analysis of RGS19 in paraffin-embedded formalin-fixed human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
Western Blot: RGS19 Antibody [NBP2-24516] - Analysis of RGS19 in mouse placenta lysate in the 1) absence and 2) presence of immunizing peptide using NBP2-24516 at 1.0 ug/ml.
Species: Hu, Mu
Applications: IHC, IHC-P, WB
SUCLG1 Antibody
NBP1-32728
Immunocytochemistry/Immunofluorescence: SUCLG1 Antibody [NBP1-32728] - Sample: HeLa cells were fixed in 2% paraformaldehyde/culture medium at 37C for 30 min. Green: SUCLG1 protein stained by SUCLG1 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-32728] - N87 xenograft, using SUCLG1antibody at 1:100 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: SUCLG1 Antibody [NBP1-32728] - Sample (20 ug of whole cell lysate) A: mouse brain 10% SDS PAGE; antibody diluted at 1:10000.
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
RGS4 Antibody
NBP2-94071
Immunocytochemistry/Immunofluorescence: RGS4 Antibody [NBP2-94071] - Analysis of L929 cells using RGS4 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: RGS4 Antibody [NBP2-94071] - Analysis of U-2 OS cells using RGS4 at dilution of 1:100. Blue: DAPI for nuclear staining.
Western Blot: RGS4 Antibody [NBP2-94071] - Analysis of extracts of various cell lines, using RGS4 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 1s.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
GPR151 Antibody -
BSA Free
NLS418
Immunohistochemistry-Paraffin: GPR151 Antibody [NLS418] - Analysis of anti-GPR151 antibody with brain, thalamus at 2 ug/ ml.
Immunohistochemistry-Paraffin: GPR151 Antibody [NLS418] - Analysis of anti-GPR151 antibody with human brain, glioblastoma.
Immunohistochemistry-Paraffin: GPR151 Antibody [NLS418] - Anti-GPR151 antibody IHC of human Lung, Non-Small Cell Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Hu
Applications: IHC, IHC-P
MRGX1 Antibody -
BSA Free
NLS2756
Immunohistochemistry-Paraffin: MRGX1 Antibody [NLS2756] - Analysis of anti-MRGPRX1 / MRGX1 antibody with human ganglion cells and Schwann cells.
Immunohistochemistry-Paraffin: MRGX1 Antibody [NLS2756] - Anti-MRGX1 / MRGPRX1 antibody IHC of human Ovary, Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: MRGX1 Antibody [NLS2756] - Anti-MRGX1 / MRGPRX1 antibody IHC of human Skin, Melanoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Lgr6 Antibody
(918719) [Unconjugate
MAB8458
HEK293 human embryonic kidney cell line transfected with human Lgr6 and eGFP was stained with either (A) Mouse Anti-Human Lgr6 Monoclonal Antibody (Catalog # MAB8458) or (B) Mouse IgG1 Isotype Control (Catalog # MAB002) followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B).
Lgr6 was detected in immersion fixed HEK293 human embryonic kidney cell line transfected with human Lgr6 and eGFP (green) using Mouse Anti-Human Lgr6 Monoclonal Antibody (Catalog # MAB8458) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
(1 Publication)
Species: Hu
Applications: CyTOF-ready, Flow, ICC
LPAR3/LPA3/EDG-7
Antibody - BSA Free
NLS1017
Immunohistochemistry-Paraffin: LPAR2/LPA2/EDG-4 Antibody [NLS1017] - Anti-LPAR3 / LPA3 / EDG7 antibody IHC of human Colon, Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: LPAR2/LPA2/EDG-4 Antibody [NLS1017] - Analysis of anti-EDG7 antibody with human brain, amygdala.
Immunohistochemistry-Paraffin: LPAR2/LPA2/EDG-4 Antibody [NLS1017] - Anti-LPAR3 / LPA3 / EDG7 antibody IHC of human heart, myocardial infarct. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
GPRC6A Antibody -
BSA Free
NLS2576
Immunohistochemistry-Paraffin: GPRC6A Antibody [NLS2576] - Human Ovary, Carcinoma formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: GPRC6A Antibody [NLS2576] - Breast, carcinoma
Immunohistochemistry-Paraffin: GPRC6A Antibody [NLS2576] - Brain, Hypothalamus, neurons of the tuberal nucleus
(3 Publications)
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
RGS3 Antibody
(1E8-C7)
H00005998-M01
Western Blot: RGS3 Antibody (1E8-C7) [H00005998-M01] - Analysis of RGS3 expression in transfected 293T cell line by RGS3 monoclonal antibody (M01), clone 1E8-C7.Lane 1: RGS3 transfected lysate(19.5 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: RGS3 Antibody (1E8-C7) [H00005998-M01] - Analysis of monoclonal antibody to RGS3 on HeLa cell . Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: RGS3 Antibody (1E8-C7) [H00005998-M01] - Analysis of monoclonal antibody to RGS3 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Frizzled-4
Antibody (145901)
MAB194
Frizzled-4 Antibody (145901)
(4 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
RGS18 Antibody
NBP2-24417
Western Blot: RGS18 Antibody [NBP2-24417] - Western blot analysis of RGS18 in 1) transfected 293T cells and 2) untransfected 293T cells using NBP2-24417 at 1:500.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, WB
RGS5 Antibody
(OTI1C1)
NBP2-00880
Western Blot: RGS5 Antibody (OTI1C1) [NBP2-00880] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RGS5 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-RGS5.
Immunohistochemistry-Paraffin: RGS5 Antibody (OTI1C1) [NBP2-00880] - Staining of paraffin-embedded Human pancreas tissue within the normal limits using anti-RGS5 mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100 degrees C for 10min)
Flow Cytometry: RGS5 Antibody (OTI1C1) [NBP2-00880] - HEK293T cells transfected with either overexpress plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-RGS5 antibody and then analyzed by flow cytometry.
(5 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
IL-12
[Unconjugated]
419-ML/CF
1 μg/lane of Recombinant Mouse IL-12 was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing single bands at 25 kDa and 43 kDa (R) and 68 kDa (NR) .
Recombinant Mouse IL-12 (Catalog # 419‑ML/CF) stimulates cell proliferation of PHA-activated mouse splenocytes. The ED50 for this effect is 0.01-0.1 ng/mL.
(239 Publications)
Species: Mu
Applications: BA
RGS1 Antibody
NBP2-82338
RGS1 Antibody
Species: Hu
Applications: WB

Publications for RGS1 Antibody (NBP2-82338) (0)

There are no publications for RGS1 Antibody (NBP2-82338).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS1 Antibody (NBP2-82338) (0)

There are no reviews for RGS1 Antibody (NBP2-82338). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RGS1 Antibody (NBP2-82338) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RGS1 Products

Bioinformatics Tool for RGS1 Antibody (NBP2-82338)

Discover related pathways, diseases and genes to RGS1 Antibody (NBP2-82338). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS1 Antibody (NBP2-82338)

Discover more about diseases related to RGS1 Antibody (NBP2-82338).
 

Pathways for RGS1 Antibody (NBP2-82338)

View related products by pathway.

PTMs for RGS1 Antibody (NBP2-82338)

Learn more about PTMs related to RGS1 Antibody (NBP2-82338).
 

Research Areas for RGS1 Antibody (NBP2-82338)

Find related products by research area.

Blogs on RGS1

There are no specific blogs for RGS1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RGS1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RGS1