Recombinant Human REXO4 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human REXO4 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 323-422 of Human REXO4
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: LVGHALHNDLKVLFLDHPKKKIRDTQKYKPFKSQVKSGRPSLRLLSEKILGLQVQQAEHCSIQDAQAAMRLYVMVKKEWESMARDRRPLLTAPDHCSDDA

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: REXO4
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 36.74 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human REXO4 GST (N-Term) Protein

• EC 3.1
• Exonuclease XPMC2
• hPMC2
• PMC2
• Prevents mitotic catastrophe 2 protein homolog
• REX4, RNA exonuclease 4 homolog (S. cerevisiae)
• RNA exonuclease 4
• Xenopus prevents mitotic catastrophe 2 homolog
• Xenopus prevents mitotic catatrophe 2 homolog
• XPMC2 prevents mitotic catastrophe 2 homolog (Xenopus laevis)
• XPMC2 prevents mitotic catastrophe 2 homolog
• XPMC2
• XPMC2HREX4

Background

REXO4 - XPMC2 prevents mitotic catastrophe 2 homolog (Xenopus laevis)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: REXO4