Relaxin R1/LGR7 Antibody

Images

 
Western Blot: LGR7 Antibody [NBP1-89585] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-317
Immunohistochemistry-Paraffin: LGR7 Antibody [NBP1-89585] - Staining of human oral mucosa shows moderate cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Relaxin R1/LGR7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PFKEMIHRFWYNYRQRKSMDSKGQKTYAPSFIWVEMWPLQEMPPELMKPDLFTYPCEMSLISQSTRLNS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RXFP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Relaxin R1/LGR7 Protein (NBP1-89585PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Relaxin R1/LGR7 Antibody

  • leucine-rich repeat-containing G protein-coupled receptor 7
  • Leucine-rich repeat-containing G-protein coupled receptor 7
  • LGR7
  • LGR7.1
  • LGR7.10
  • LGR7LGR7.2
  • MGC138347
  • MGC142177
  • Relaxin family peptide receptor 1
  • Relaxin R1
  • relaxin receptor 1
  • relaxin/insulin-like family peptide receptor 1
  • RelaxinR1
  • RXFP1
  • RXFPR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3107
Species: Hu
Applications: WB, IHC
NBP1-81223
Species: Hu
Applications: IHC, IHC-P
NBP1-86343
Species: Hu
Applications: WB, IHC, IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NLS418
Species: Hu
Applications: IHC-P
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00441931-R02
Species: Hu
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00442206-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89585
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Relaxin R1/LGR7 Antibody (NBP1-89585) (0)

There are no publications for Relaxin R1/LGR7 Antibody (NBP1-89585).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Relaxin R1/LGR7 Antibody (NBP1-89585) (0)

There are no reviews for Relaxin R1/LGR7 Antibody (NBP1-89585). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Relaxin R1/LGR7 Antibody (NBP1-89585) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Relaxin R1/LGR7 Products

Bioinformatics Tool for Relaxin R1/LGR7 Antibody (NBP1-89585)

Discover related pathways, diseases and genes to Relaxin R1/LGR7 Antibody (NBP1-89585). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Relaxin R1/LGR7 Antibody (NBP1-89585)

Discover more about diseases related to Relaxin R1/LGR7 Antibody (NBP1-89585).
 

Pathways for Relaxin R1/LGR7 Antibody (NBP1-89585)

View related products by pathway.

PTMs for Relaxin R1/LGR7 Antibody (NBP1-89585)

Learn more about PTMs related to Relaxin R1/LGR7 Antibody (NBP1-89585).
 

Research Areas for Relaxin R1/LGR7 Antibody (NBP1-89585)

Find related products by research area.

Blogs on Relaxin R1/LGR7

There are no specific blogs for Relaxin R1/LGR7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Relaxin R1/LGR7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RXFP1
Entrez