Reduced Folate Carrier/SLC19A1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Reduced Folate Carrier/SLC19A1 Antibody [NBP1-83430] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane.
Immunohistochemistry-Paraffin: Reduced Folate Carrier/SLC19A1 Antibody [NBP1-83430] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Reduced Folate Carrier/SLC19A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC19A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Reduced Folate Carrier/SLC19A1 Protein (NBP1-83430PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Reduced Folate Carrier/SLC19A1 Antibody

  • CHMD
  • FLOT1
  • folate transporter 1
  • FOLT
  • FOLThuman reduced folate carrier (RFC)10Intestinal folate carrier 1
  • IFC1
  • IFC-1
  • Placental folate transporter
  • Reduced folate carrier protein
  • REFC
  • RFC
  • RFC1
  • SLC19A1
  • solute carrier family 19 (folate transporter), member 1
  • Solute carrier family 19 member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-31266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP1-86944
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06603
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-791
Species: Hu
Applications: WB, IHC, PEP-ELISA
NBP1-57749
Species: Hu
Applications: WB, IHC
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-26666
Species: Mu
Applications: B/N, Flow, IP, In vitro
NBP2-48965
Species: Hu
Applications: IHC
NBP1-44091
Species: Hu
Applications: WB, ELISA, IHC
NBP2-24457
Species: Hu, Mu, Pm
Applications: WB, IHC-P
MAB5646
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-56070
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-55120
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-83430) (0)

There are no publications for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-83430).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-83430) (0)

There are no reviews for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-83430). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-83430) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Reduced Folate Carrier/SLC19A1 Products

Bioinformatics Tool for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-83430)

Discover related pathways, diseases and genes to Reduced Folate Carrier/SLC19A1 Antibody (NBP1-83430). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-83430)

Discover more about diseases related to Reduced Folate Carrier/SLC19A1 Antibody (NBP1-83430).
 

Pathways for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-83430)

View related products by pathway.

PTMs for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-83430)

Learn more about PTMs related to Reduced Folate Carrier/SLC19A1 Antibody (NBP1-83430).

Blogs on Reduced Folate Carrier/SLC19A1

There are no specific blogs for Reduced Folate Carrier/SLC19A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Reduced Folate Carrier/SLC19A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC19A1
Entrez