RCSD 1 Antibody

Images

 
Immunohistochemistry-Paraffin: RCSD 1 Antibody [NBP2-13214] - Staining of human lymph node shows strong cytoplasmic positivity in cells outside the reaction centra.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RCSD 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EVPVSFDQPPEGSHLPCYNKVRTRGSIKRRPPSRRFRRSQSDCGELGDFR AVESSQQNGAKEEDGDEVLPSKSKAPGSPLSSEGAAGEGVRTLGPAEKPP LRRSPSRTEKQEEDRATEEAKNGEK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RCSD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RCSD 1 Protein (NBP2-13214PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RCSD 1 Antibody

  • capZ-interacting protein
  • CAPZIP
  • MGC126585
  • MGC126611
  • MGC21854
  • MK2S4
  • Protein kinase substrate CapZIP
  • protein kinase substrate MK2S4
  • RCSD domain containing 1
  • RCSD domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1519
Species: Hu
Applications: WB, IHC
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
H00009261-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-02500
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86632
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
H00007867-M02
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, PLA
NBP1-85922
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85614
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90626
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12553
Species: Hu
NBP2-57588
Species: Hu
Applications: WB, ICC/IF
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
AF8107
Species: Hu
Applications: WB, IHC
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
NBP1-85214
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RCSD 1 Antibody (NBP2-13214) (0)

There are no publications for RCSD 1 Antibody (NBP2-13214).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RCSD 1 Antibody (NBP2-13214) (0)

There are no reviews for RCSD 1 Antibody (NBP2-13214). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RCSD 1 Antibody (NBP2-13214) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RCSD 1 Products

Bioinformatics Tool for RCSD 1 Antibody (NBP2-13214)

Discover related pathways, diseases and genes to RCSD 1 Antibody (NBP2-13214). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RCSD 1 Antibody (NBP2-13214)

Discover more about diseases related to RCSD 1 Antibody (NBP2-13214).
 

Pathways for RCSD 1 Antibody (NBP2-13214)

View related products by pathway.

PTMs for RCSD 1 Antibody (NBP2-13214)

Learn more about PTMs related to RCSD 1 Antibody (NBP2-13214).
 

Research Areas for RCSD 1 Antibody (NBP2-13214)

Find related products by research area.

Blogs on RCSD 1

There are no specific blogs for RCSD 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RCSD 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RCSD1