MAPKAP Kinase 3 Antibody (2B5)

Images

 
Western Blot: MAPKAP Kinase 3 Antibody (2B5) [H00007867-M02] - MAPKAPK3 monoclonal antibody (M02), clone 2B5 Analysis of MAPKAPK3 expression in HeLa.
Immunohistochemistry-Paraffin: MAPKAP Kinase 3 Antibody (2B5) [H00007867-M02] - Analysis of monoclonal antibody to MAPKAPK3 on FFPE human placenta. Antibody concentration 3 ug/mL.
Western Blot: MAPKAP Kinase 3 Antibody (2B5) [H00007867-M02] - MAPKAPK3 monoclonal antibody (M02), clone 2B5. Analysis of MAPKAPK3 expression in NIH/3T3.
Proximity Ligation Assay: MAPKAP Kinase 3 Antibody (2B5) [H00007867-M02] - Analysis of protein-protein interactions between MAPK13 and MAPKAPK3. HeLa cells were stained with anti-MAPK13 rabbit purified polyclonal 1:1200 ...read more
Sandwich ELISA: MAPKAP Kinase 3 Antibody (2B5) [H00007867-M02] - Detection limit for recombinant GST tagged MAPKAPK3 is approximately 0.03ng/mL as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, PLA, S-ELISA
Clone
2B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MAPKAP Kinase 3 Antibody (2B5) Summary

Immunogen
MAPKAPK3 (AAH01662, 272 a.a. ~ 382 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EVSEDAKQLIRLLLKTDPTERLTITQFMNHPWINQSMVVPQTPLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNRLLNKRRKKQAGSSSASQGCNNQ
Specificity
MAPKAPK3 - mitogen-activated protein kinase-activated protein kinase 3
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAPKAPK3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Proximity Ligation Assay
  • Sandwich ELISA
Control
MAPKAP Kinase 3 Knockout HeLa Cell Lysate

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MAPKAP Kinase 3 Antibody (2B5)

  • 3PKEC 2.7.11.1
  • Chromosome 3p kinase
  • EC 2.7.11
  • MAP kinase-activated protein kinase 3
  • MAPK-activated protein kinase 3
  • MAPKAP kinase 3
  • MAPKAP33pK
  • MAPKAPK-3
  • mitogen-activated protein kinase-activated protein kinase 3

Background

This gene encodes a member of the Ser/Thr protein kinase family. This kinase functions as a mitogen-activated protein kinase (MAP kinase)- activated protein kinase. MAP kinases are also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This kinase was shown to be activated by growth inducers and stress stimulation of cells. In vitro studies demonstrated that ERK, p38 MAP kinase and Jun N-terminal kinase were all able to phosphorylate and activate this kinase, which suggested the role of this kinase as an integrative element of signaling in both mitogen and stress responses. This kinase was reported to interact with, phosphorylate and repress the activity of E47, which is a basic helix-loop-helix transcription factor known to be involved in the regulation of tissue-specific gene expression and cell differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009261-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, PLA, S-ELISA
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NB500-138
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P, Flow-IC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-52508
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
MAB4640
Species: Hu
Applications: WB
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
H00010598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-16991
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-82050
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC

Publications for MAPKAP Kinase 3 Antibody (H00007867-M02) (0)

There are no publications for MAPKAP Kinase 3 Antibody (H00007867-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAPKAP Kinase 3 Antibody (H00007867-M02) (0)

There are no reviews for MAPKAP Kinase 3 Antibody (H00007867-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAPKAP Kinase 3 Antibody (H00007867-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MAPKAP Kinase 3 Products

Bioinformatics Tool for MAPKAP Kinase 3 Antibody (H00007867-M02)

Discover related pathways, diseases and genes to MAPKAP Kinase 3 Antibody (H00007867-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAPKAP Kinase 3 Antibody (H00007867-M02)

Discover more about diseases related to MAPKAP Kinase 3 Antibody (H00007867-M02).
 

Pathways for MAPKAP Kinase 3 Antibody (H00007867-M02)

View related products by pathway.

PTMs for MAPKAP Kinase 3 Antibody (H00007867-M02)

Learn more about PTMs related to MAPKAP Kinase 3 Antibody (H00007867-M02).
 

Research Areas for MAPKAP Kinase 3 Antibody (H00007867-M02)

Find related products by research area.

Blogs on MAPKAP Kinase 3

There are no specific blogs for MAPKAP Kinase 3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAPKAP Kinase 3 Antibody (2B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPKAPK3
Entrez
OMIM
Uniprot