RBM5 Recombinant Protein Antigen

Images

 
There are currently no images for RBM5 Protein (NBP1-83305PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RBM5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RBM5.

Source: E. coli

Amino Acid Sequence: WSSTQSQSGEGGSVDYSYLQPGQDGYAQYAQYSQDYQQFYQQQAGGLESDASSASGTAVTTTSAAVVSQSPQLYNQTSNPPGSPTEEAQPSTSTSTQAPAASPTGVVPGTKYAVPDTSTYQYDESSGYYY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RBM5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83305.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RBM5 Recombinant Protein Antigen

  • G15
  • H37
  • LUCA15FLJ39876
  • Protein G15
  • Putative tumor suppressor LUCA15
  • Renal carcinoma antigen NY-REN-9
  • RMB5
  • RNA binding motif protein 5
  • RNA-binding motif protein 5
  • RNA-binding protein 5

Background

RNA-binding motif protein 5 (RBM5) is also known as LUCA-15. The RBM5 gene is located within a region highly susceptible to deletions in lung cancer and is implicated to be a tumor suppressor. RBM5 bears two RRM domains, one RanBP2-type zinc finger, one C2H2-type zinc finger, and a G-patch domain. It has been found to be a component of the spliceosome, a complex that regulates alternative splicing and is involved in the regulation of proliferation and apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5534
Species: Hu
Applications: Flow, IHC, WB
NBP1-89377
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-84010
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00221527-B01P
Species: Hu
Applications: ICC/IF, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
AF3194
Species: Hu
Applications: ICC, Simple Western, WB
H00063940-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NB120-13550
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-47931
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
AF756
Species: Mu
Applications: IHC, WB
NBP2-94913
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP3-37921
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-84951
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP3-46906
Species: Hu, Mu, Rt
Applications: ELISA, WB
AF6438
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, Simple Western, WB

Publications for RBM5 Protein (NBP1-83305PEP) (0)

There are no publications for RBM5 Protein (NBP1-83305PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM5 Protein (NBP1-83305PEP) (0)

There are no reviews for RBM5 Protein (NBP1-83305PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RBM5 Protein (NBP1-83305PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RBM5 Products

Blogs on RBM5

There are no specific blogs for RBM5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RBM5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM5