RBM44 Antibody

Images

 
Immunohistochemistry-Paraffin: RBM44 Antibody [NBP1-93779] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: RBM44 Antibody [NBP1-93779] - Staining of human endometrium shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: RBM44 Antibody [NBP1-93779] - Staining in human testis and endometrium tissues using anti-RBM44 antibody. Corresponding RBM44 RNA-seq data are presented for ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

RBM44 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YRESAEDTQKHDTDEDSQQEYHSAEEQEYISNHLSFDQTKALDISNPEVVELGNSGYEVKCASNVEDNRVNSGSGSIISFDSLDVYGQEESLHVSKFQNSVMLREYHDLKHEKYKEQETNSMYHTVFDGSVLRSNSPGNQESQSKSG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBM44
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RBM44 Protein (NBP1-93779PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBM44 Antibody

  • RNA binding motif protein 44
  • RNA-binding motif protein 44

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20605
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-90201
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-84880
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NBP1-87262
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-91778
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB200-112
Species: Ca, Ha, Hu, Pm, Mu, Po, Pm, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, IP, KD, WB
NBP1-93779
Species: Hu
Applications: IHC, IHC-P

Publications for RBM44 Antibody (NBP1-93779) (0)

There are no publications for RBM44 Antibody (NBP1-93779).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM44 Antibody (NBP1-93779) (0)

There are no reviews for RBM44 Antibody (NBP1-93779). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RBM44 Antibody (NBP1-93779) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBM44 Products

Array NBP1-93779

Bioinformatics Tool for RBM44 Antibody (NBP1-93779)

Discover related pathways, diseases and genes to RBM44 Antibody (NBP1-93779). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for RBM44 Antibody (NBP1-93779)

View related products by pathway.

Blogs on RBM44

There are no specific blogs for RBM44, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM44 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM44