RBBP4/RbAp48 Recombinant Protein Antigen

Images

 
There are currently no images for RBBP4/RbAp48 Recombinant Protein Antigen (NBP2-46858PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RBBP4/RbAp48 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RBBP4/RbAp48

Source: E. coli

Amino Acid Sequence: QWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RBBP4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-46858.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RBBP4/RbAp48 Recombinant Protein Antigen

  • CAF-1 p48
  • CAF-1 subunit C
  • CAF-1C
  • CAF-I p48
  • Chromatin assembly factor 1 subunit C
  • Chromatin assembly factor I p48 subunit
  • chromatin assembly factor/CAF-1 p48 subunit
  • histone-binding protein RBBP4
  • MSI1 protein homolog
  • Nucleosome-remodeling factor subunit RBAP48
  • NURF55
  • RBAP48
  • RBBP4
  • RBBP-4
  • retinoblastoma binding protein 4
  • Retinoblastoma-binding protein 4CAF-I 48 kDa subunit
  • Retinoblastoma-binding protein p48

Background

RbAp48 encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-27151
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NB500-207
Species: Hu
Applications: ICC/IF, IP, WB
NB500-212
Species: Hu
Applications: ICC/IF, IP, KD, WB
H00029883-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-15930
Species: Hu
Applications: ICC/IF, WB
NBP1-87109
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF5215
Species: Hu, Mu
Applications: ICC, WB
NBP3-46113
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, , WB
NBL1-11570
Species: Hu
Applications: WB
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
NBL1-11567
Species: Hu
Applications: WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
NB300-517
Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
NBP2-46858PEP
Species: Hu
Applications: AC

Publications for RBBP4/RbAp48 Recombinant Protein Antigen (NBP2-46858PEP) (0)

There are no publications for RBBP4/RbAp48 Recombinant Protein Antigen (NBP2-46858PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBBP4/RbAp48 Recombinant Protein Antigen (NBP2-46858PEP) (0)

There are no reviews for RBBP4/RbAp48 Recombinant Protein Antigen (NBP2-46858PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RBBP4/RbAp48 Recombinant Protein Antigen (NBP2-46858PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RBBP4/RbAp48 Products

Research Areas for RBBP4/RbAp48 Recombinant Protein Antigen (NBP2-46858PEP)

Find related products by research area.

Blogs on RBBP4/RbAp48

There are no specific blogs for RBBP4/RbAp48, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RBBP4/RbAp48 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RBBP4