RARRES1 Antibody - BSA Free

Immunohistochemistry-Paraffin: RARRES1 Antibody [NBP1-80684] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RARRES1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RARRES1 Antibody - BSA Free (NBP1-80684) is a polyclonal antibody validated for use in IHC and WB. Anti-RARRES1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VVFSTERYNPESLLQEGEGRLGKCSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYLLYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RARRES1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RARRES1 Protein (NBP1-80684PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RARRES1 Antibody - BSA Free

• RARRES1
• RAR-responsive protein TIG1
• retinoic acid receptor responder (tazarotene induced) 1
• retinoic acid receptor responder protein 1
• TIG1
• TIG1Tazarotene-induced gene 1 protein

Background

RARRES1, also known as Retinoic acid receptor responder protein 1, consists of a 33 kDa and a shorter 25 kDa isoform. The primary function of RARRES1 is to encode a type 1 membrane protein. RARRES1 is currently being studied for its relation to colon cancer, gastric cancer, nasopharyngitis, psoriasis, prostate carcinoma, carcinoma and schizophrenia. RARRES1 is linked to the gene silencing, localization, methylation, cell proliferation, cell growth and RNA interference pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RARRES1 Antibody (NBP1-80684)(2)

Publications using NBP1-80684

• Gomez GA, Rundle CH, Xing W et al. Contrasting effects of <i>Ksr2</i>, an obesity gene, on trabecular bone volume and bone marrow adiposity eLife 2022-11-07 [PMID: 36342465] (IHC-P, Mouse)
  
  Details:
  Dilution used in IHC-P 1:100
• Stimac V, Koprivec I, Manenica M et al. Augmin prevents merotelic attachments by promoting proper arrangement of bridging and kinetochore fibers eLife 2022-10-21 [PMID: 36269126] (WB, Human)
  
  Details:
  Dilution used in WB 1:1000

Bioinformatics

• Gene Symbol: RARRES1
• Entrez:
  • 5918(Human)
• Uniprot:
  • P49788()
  • P49788()
  • P49788()
  • P49788()