RAR gamma/NR1B3 Antibody

Western Blot: RAR gamma/NR1B3 Antibody [NBP2-47314] - Analysis in human cell line CAPAN-2.

Immunocytochemistry/Immunofluorescence: RAR gamma/NR1B3 Antibody [NBP2-47314] - Staining of human cell line PC-3 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RAR gamma/NR1B3 Antibody [NBP2-47314] - Staining of human Lymph node shows strong nuclear positivity in germinal and non-germinal center cells.

Immunohistochemistry-Paraffin: RAR gamma/NR1B3 Antibody [NBP2-47314] - Staining of human Cerebral cortex shows strong nuclear positivity in neuronal and glial cells.

Immunohistochemistry-Paraffin: RAR gamma/NR1B3 Antibody [NBP2-47314] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: RAR gamma/NR1B3 Antibody [NBP2-47314] - Staining of human Skin shows strong nuclear positivity in squamous epithelial cells.

Product Discontinued

RAR gamma/NR1B3 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVET
• Predicted Species: Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RARG
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RAR gamma/NR1B3 Antibody

• NR1B3
• NR1B3RARC
• Nuclear receptor subfamily 1 group B member 3
• RAR gamma
• RARC
• RARG
• RAR-gamma
• retinoic acid receptor gamma
• retinoic acid receptor, gamma

Background

Retinoids can reverse various premalignant lesions as well as prevent some second primary tumors. The effects of retinoids are regulated by retinoic acid receptors (RAR) and retinoid X receptors, which act as ligand-activated transcription factors. Ligand-dependent transcriptional activation of RARs is a multistep process that ends with the formation of a multimeric co-activator complex on regulated promoters. Retinoic acid receptor gamma has been shown to be the most important retinoid receptor for regulation of retinoic acid turnover rate and retinoic acid induced growth inhibition. While RAR mRNA levels may be useful biomarkers for various diseases, RAR gamma expression is decreased in Barrett's tissues compared with normal tissue.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAR gamma/NR1B3 Antibody (NBP2-47314)(1)

Publication using NBP2-47314

• Burda JE, O'Shea TM, Ao Y et al. Divergent transcriptional regulation of astrocyte reactivity across disorders Nature 2022-05-25 [PMID: 35614216] (IHC-Fr, Mouse)

Bioinformatics

• Gene Symbol: RARG