RAR gamma/NR1B3 Antibody

Images

 
Western Blot: RAR gamma/NR1B3 Antibody [NBP2-47314] - Analysis in control (vector only transfected HEK293T lysate) and RARG over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunocytochemistry/ Immunofluorescence: RAR gamma/NR1B3 Antibody [NBP2-47314] - Staining of human cell line PC-3 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RAR gamma/NR1B3 Antibody [NBP2-47314] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
Western Blot: RAR gamma/NR1B3 Antibody [NBP2-47314] - Analysis in human cell line MCF-7.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAR gamma/NR1B3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVET
Specificity
Specificity of human RAR gamma/NR1B3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RARG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
RAR gamma/NR1B3 Knockout HeLa Cell Lysate
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAR gamma/NR1B3 Antibody

  • NR1B3
  • NR1B3RARC
  • Nuclear receptor subfamily 1 group B member 3
  • RAR gamma
  • RARC
  • RARG
  • RAR-gamma
  • retinoic acid receptor gamma
  • retinoic acid receptor, gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45516
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-81776
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-58922
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00002158-M01
Species: Hu
Applications: WB, ELISA, IP, RNAi
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-539
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fe, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56530
Species: Hu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-85464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, CHIP-SEQ

Publications for RAR gamma/NR1B3 Antibody (NBP2-47314) (0)

There are no publications for RAR gamma/NR1B3 Antibody (NBP2-47314).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAR gamma/NR1B3 Antibody (NBP2-47314) (0)

There are no reviews for RAR gamma/NR1B3 Antibody (NBP2-47314). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAR gamma/NR1B3 Antibody (NBP2-47314) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RAR gamma/NR1B3 Products

Bioinformatics Tool for RAR gamma/NR1B3 Antibody (NBP2-47314)

Discover related pathways, diseases and genes to RAR gamma/NR1B3 Antibody (NBP2-47314). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAR gamma/NR1B3 Antibody (NBP2-47314)

Discover more about diseases related to RAR gamma/NR1B3 Antibody (NBP2-47314).
 

Pathways for RAR gamma/NR1B3 Antibody (NBP2-47314)

View related products by pathway.

Research Areas for RAR gamma/NR1B3 Antibody (NBP2-47314)

Find related products by research area.

Blogs on RAR gamma/NR1B3

There are no specific blogs for RAR gamma/NR1B3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAR gamma/NR1B3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RARG