We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

RAR gamma/NR1B3 Antibody

Images

 
Western Blot: RAR gamma/NR1B3 Antibody [NBP2-47314] - Analysis in human cell line CAPAN-2.
Immunocytochemistry/ Immunofluorescence: RAR gamma/NR1B3 Antibody [NBP2-47314] - Staining of human cell line PC-3 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RAR gamma/NR1B3 Antibody [NBP2-47314] - Staining of human Lymph node shows strong nuclear positivity in germinal and non-germinal center cells.
Immunohistochemistry-Paraffin: RAR gamma/NR1B3 Antibody [NBP2-47314] - Staining of human Cerebral cortex shows strong nuclear positivity in neuronal and glial cells.
Immunohistochemistry-Paraffin: RAR gamma/NR1B3 Antibody [NBP2-47314] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RAR gamma/NR1B3 Antibody [NBP2-47314] - Staining of human Skin shows strong nuclear positivity in squamous epithelial cells.

Product Details

Summary
Product Discontinued
View other related RAR gamma/NR1B3 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-47314
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RAR gamma/NR1B3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVET
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RARG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Publications
Read Publication using
NBP2-47314 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAR gamma/NR1B3 Antibody

  • NR1B3
  • NR1B3RARC
  • Nuclear receptor subfamily 1 group B member 3
  • RAR gamma
  • RARC
  • RARG
  • RAR-gamma
  • retinoic acid receptor gamma
  • retinoic acid receptor, gamma

Background

Retinoids can reverse various premalignant lesions as well as prevent some second primary tumors. The effects of retinoids are regulated by retinoic acid receptors (RAR) and retinoid X receptors, which act as ligand-activated transcription factors. Ligand-dependent transcriptional activation of RARs is a multistep process that ends with the formation of a multimeric co-activator complex on regulated promoters. Retinoic acid receptor gamma has been shown to be the most important retinoid receptor for regulation of retinoic acid turnover rate and retinoic acid induced growth inhibition. While RAR mRNA levels may be useful biomarkers for various diseases, RAR gamma expression is decreased in Barrett's tissues compared with normal tissue.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45516
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-98903
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP3-46820
Species: Hu
Applications: ELISA, IHC, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-00637
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-60518
Species: Hu
Applications: ELISA, S-ELISA
NBP3-16627
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-16601
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56530
Species: Hu
Applications: WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-16602
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-89544
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-85464
Species: Hu
Applications: ICC/IF,  IHC-P, WB
NBP1-28863
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB

Publications for RAR gamma/NR1B3 Antibody (NBP2-47314)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC-Fr.


Filter By Application
IHC-Fr
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for RAR gamma/NR1B3 Antibody (NBP2-47314) (0)

There are no reviews for RAR gamma/NR1B3 Antibody (NBP2-47314). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAR gamma/NR1B3 Antibody (NBP2-47314) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAR gamma/NR1B3 Products

Research Areas for RAR gamma/NR1B3 Antibody (NBP2-47314)

Find related products by research area.

Blogs on RAR gamma/NR1B3

There are no specific blogs for RAR gamma/NR1B3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAR gamma/NR1B3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RARG