RAR beta/NR1B2 Antibody

Immunohistochemistry-Paraffin: RAR beta/NR1B2 Antibody [NBP1-81776] - Analysis in human placenta and pancreas tissues using NBP1-81776 antibody. Corresponding RARB RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: RAR beta/NR1B2 Antibody [NBP1-81776] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RAR beta/NR1B2 Antibody [NBP1-81776] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: RAR beta/NR1B2 Antibody [NBP1-81776] - Staining of human pancreas shows weak nuclear positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: RAR beta/NR1B2 Antibody [NBP1-81776] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: RAR beta/NR1B2 Antibody [NBP1-81776] - Staining of human rectum shows strong nuclear positivity in glandular cells.

Product Discontinued

RAR beta/NR1B2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGV
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RARB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC reported in the literature (PMID: 26634247)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26634247).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RAR beta/NR1B2 Antibody

• beta polypeptide
• HAP
• HBV-activated protein
• NR1B2
• RAR beta
• RARB
• retinoic acid receptor, beta
• RRB2

Background

Retinoids can reverse various premalignant lesions as well as prevent some second primary tumors. The effects of retinoids are regulated by retinoic acid receptors (RAR) and retinoid X receptors, which act as ligand-activated transcription factors. Ligand-dependent transcriptional activation of RARs is a multistep process that ends with the formation of a multimeric co-activator complex on regulated promoters (1,2). Loss of RAR-beta expression and the accumulation of p53 and Ki67 proteins may help in the early identification of esophageal cancer in high-risk populations (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAR beta/NR1B2 Antibody (NBP1-81776)(1)

Publication using NBP1-81776

• Seidensaal K, Nollert A, Feige AH et al. Impaired aldehyde dehydrogenase 1 subfamily member 2A-dependent retinoic acid signaling is related with a mesenchymal-like phenotype and an unfavorable prognosis of head and neck squamous cell carcinoma. Mol Cancer 2015-12-03 [PMID: 26634247] (IF/IHC, Human)

FAQs for RAR beta/NR1B2 Antibody (NBP1-81776). (Showing 1 - 1 of 1 FAQ).

1. I am planning to perform IHC staining of RARB on FFPE samples. I have found the reference "J Cutan Pathol 2009;36; 1141-1145" used an antibody from your company. Would you let me know any other references using the antibody for IHC staining of RARB?
   • Unfortunately we are not aware of any other publication wherein our Retinoic Acid Receptor beta antibodies were cited for their use in IHC application. From our sales records, it looks like the researcher used catalog number NB200-323 in the publication you mentioned. Retinoic Acid Receptor beta antibody NB200-323 is our best selling product among this category and it has also been cited for its use in WB application by Yang et al. in Am J Physiol Renal Physiol. 2008 Jun;294(6):F1433-40. We have at least 7 primary antibody products to Retinoic Acid Receptor beta that have been validated for IHC-P application.. We stand behind the quality of our products and offer 100% guarantee for the applications/species mentioned on the datasheets. We are always there to help if you come up with any difficulties and yes, we provide replacements/refunds after troubleshooting a problem, if you do not get your desired outcome! Therefore, please let us know if you have any specific questions or concerns on the IHC-P application of our Retinoic Acid Receptor beta antibodies. You may contact us at technical@novusbio.com.

Bioinformatics

• Gene Symbol: RARB